Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28350 38 / 0.001 ARF ARF10 auxin response factor 10 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G013700 [exp] 87 / 3e-23 AT4G01500 52 / 6e-09 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G012850 [exp] 84 / 5e-22 AT4G01500 49 / 6e-08 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G012950 [exp] 83 / 1e-21 AT1G35520 49 / 9e-08 auxin response factor 15 (.1) Potri.003G017566 [exp] 81 / 1e-20 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1) Potri.012G013000 [exp] 79 / 8e-20 AT4G01500 46 / 9e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G013501 [exp] 78 / 1e-19 AT4G01500 48 / 3e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.003G015900 [exp] 77 / 2e-19 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1) Potri.015G015650 [exp] 77 / 2e-19 AT1G13260 50 / 6e-08 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.014G068000 [exp] 77 / 3e-19 AT1G68840 47 / 5e-07 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021467 [exp] 40 / 0.0002 AT4G30080 588 / 0.0 auxin response factor 16 (.1) Lus10030240 [exp] 38 / 0.0007 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.003G011250.1 pacid=42785590 polypeptide=Potri.003G011250.1.p locus=Potri.003G011250 ID=Potri.003G011250.1.v4.1 annot-version=v4.1 ATGGCAAATCTCAGGAAAACTCTATCCGAAACTGACGTCGAGGTAAGATTTTCAGTACCAAGTAAATGGTTCAAGGAAAATTTGTTTTCTCGATTTGAAG GTAAAAATAAATTAGATTTACCAGTTAAGGATCTAAGTGGAGAAGTGCAGTCCTTTGGTTTTTCAGTTCGAACCAAAGGGAACCACTTCAAACCTGTCAT CTCTAGGGGATGGCGTAAATTTGTTCATGCCAAGGGCTTGAAGCCTGGCAATAAGATAATTTTTGTTATGGAGAATGACCCAGAAACTGGGACAGAGTAC AAAGTAGAAGTGATTAAAGAGATCAGGCTGTTTGGAAGAGATATAGAAGGAAGGGTGTAA
AA sequence Show only first row Show all	>Potri.003G011250.1 pacid=42785590 polypeptide=Potri.003G011250.1.p locus=Potri.003G011250 ID=Potri.003G011250.1.v4.1 annot-version=v4.1 MANLRKTLSETDVEVRFSVPSKWFKENLFSRFEGKNKLDLPVKDLSGEVQSFGFSVRTKGNHFKPVISRGWRKFVHAKGLKPGNKIIFVMENDPETGTEY KVEVIKEIRLFGRDIEGRV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.003G011250 [exp]	0	1
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Potri.005G029700 [exp]	4.24	0.9514
AT1G64160			Disease resistance-responsive ...		Potri.001G096560 [exp]	6.00	0.9395
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Potri.005G029800 [exp]	6.16	0.9493
AT4G25845			unknown protein		Potri.006G167300 [exp]	6.32	0.8986
AT5G43580		UPI	UNUSUAL SERINE PROTEASE INHIBI...		Potri.009G028300 [exp]	9.48	0.9383
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Potri.005G029600 [exp]	9.59	0.9385
AT5G50200		WR3, ATNRT3.1, ...	WOUND-RESPONSIVE 3, NITRATE TR...		Potri.015G085000 [exp]	11.83	0.9193	WR3.3
AT1G64160			Disease resistance-responsive ...		Potri.013G142401 [exp]	12.36	0.9323
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Potri.001G175800 [exp]	17.74	0.9353
AT3G47570			Leucine-rich repeat protein ki...		Potri.011G102700 [exp]	19.59	0.9280

Compare expression of checked genes

Potri.003G011250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.