Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PETF.4
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G60950 176 / 2e-57 FED A, ATFD2, FEDA FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) AT1G10960 170 / 4e-55 ATFD1 ferredoxin 1 (.1) AT2G27510 140 / 4e-43 ATFD3 ferredoxin 3 (.1) AT5G10000 118 / 7e-35 ATFD4 ferredoxin 4 (.1) AT1G32550 70 / 1e-15 FdC1 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2) AT4G14890 69 / 1e-15 FdC2 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G218400 [exp] 229 / 1e-78 AT1G60950 194 / 9e-65 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.001G470700 [exp] 187 / 7e-62 AT1G60950 174 / 7e-57 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.009G163800 [exp] 151 / 8e-48 AT2G27510 167 / 7e-54 ferredoxin 3 (.1) Potri.010G239100 [exp] 150 / 3e-47 AT2G27510 175 / 7e-57 ferredoxin 3 (.1) Potri.008G020100 [exp] 149 / 5e-47 AT2G27510 180 / 5e-59 ferredoxin 3 (.1) Potri.004G202500 [exp] 149 / 1e-46 AT2G27510 164 / 3e-52 ferredoxin 3 (.1) Potri.003G090400 [exp] 67 / 3e-14 AT1G32550 257 / 3e-88 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2) Potri.010G087300 [exp] 66 / 3e-14 AT4G14890 189 / 7e-63 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Potri.008G153200 [exp] 65 / 5e-14 AT4G14890 193 / 2e-64 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015462 [exp] 162 / 4e-52 AT1G60950 182 / 8e-60 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10001369 [exp] 152 / 7e-48 AT1G60950 186 / 1e-61 FERREDOXIN 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10020616 [exp] 144 / 7e-45 AT2G27510 172 / 9e-56 ferredoxin 3 (.1) Lus10043430 [exp] 141 / 1e-43 AT2G27510 179 / 3e-58 ferredoxin 3 (.1) Lus10034144 [exp] 140 / 2e-43 AT2G27510 179 / 1e-58 ferredoxin 3 (.1) Lus10004870 [exp] 139 / 7e-43 AT2G27510 165 / 5e-53 ferredoxin 3 (.1) Lus10010557 [exp] 72 / 5e-16 AT4G14890 188 / 5e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10006116 [exp] 71 / 6e-16 AT4G14890 186 / 1e-61 ferredoxin C 2, 2Fe-2S ferredoxin-like superfamily protein (.1) Lus10000483 [exp] 67 / 2e-14 AT1G32550 245 / 7e-84 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2) Lus10004576 [exp] 66 / 7e-14 AT1G32550 248 / 6e-85 ferredoxin C 1, 2Fe-2S ferredoxin-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0486 [poplar] [flax] Fer2 PF00111 [poplar] [flax] Fer2 2Fe-2S iron-sulfur cluster binding domain
Representative CDS sequence Show only first row Show all	>Potri.003G015200.1 pacid=42787205 polypeptide=Potri.003G015200.1.p locus=Potri.003G015200 ID=Potri.003G015200.1.v4.1 annot-version=v4.1 ATGGCAACCGCAGCAGCCCTCAGTACCAGCGCCATGGTTAGCACCTCGTTTGCTAAACAAAAGCCAGTAACAAGCCTACGGGCTCTTCCCGCCGTGGGGG AGGCGCTTTTTGGCTTAAAAGCCAGTCGAGGAGGACGTGCTAAAGCAATGGCAGCGCACAAGGTGAAGCTCATCACTCCTGACGGTGAGGAGGAGTTTGA TTGCCCCACCAACGTCTACATCCTCGACCATGCTGAGGAGGCGCATGGAATGGACCTCCCATACTCATGCAGGGCTGGAGCTTGCTCTTCATGTGCTGGC AAGGTTGTGCAAGGGACTGTGGATCAGTCTGATGGTAGCTTCCTTGATGAAGACCAGATAGCGGAAGGTTGGGTTCTCACTTGTGTTGCTTATCCTACGT CTGATGTTGTCATTGAGACACACAAAGAGGAAGAGTTTAGTGCTTTTTAA
AA sequence Show only first row Show all	>Potri.003G015200.1 pacid=42787205 polypeptide=Potri.003G015200.1.p locus=Potri.003G015200 ID=Potri.003G015200.1.v4.1 annot-version=v4.1 MATAAALSTSAMVSTSFAKQKPVTSLRALPAVGEALFGLKASRGGRAKAMAAHKVKLITPDGEEEFDCPTNVYILDHAEEAHGMDLPYSCRAGACSSCAG KVVQGTVDQSDGSFLDEDQIAEGWVLTCVAYPTSDVVIETHKEEEFSAF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G60950		FED A, ATFD2, F...	FERREDOXIN 2, 2Fe-2S ferredoxi...		Potri.003G015200 [exp]	0	1	Pt-PETF.4
AT4G15510			Photosystem II reaction center...		Potri.013G006500 [exp]	1.41	0.9661
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Potri.005G151200 [exp]	2.00	0.9560
AT1G11290		CRR22	CHLORORESPIRATORY REDUCTION22,...		Potri.005G155000 [exp]	2.44	0.9543
AT2G43560			FKBP-like peptidyl-prolyl cis-...		Potri.007G134600 [exp]	5.29	0.9390
AT2G36250		ATFTSZ2-1, FTSZ...	Tubulin/FtsZ family protein (....		Potri.004G203100 [exp]	5.74	0.9087	Pt-FTSZ2.1
AT4G14890		FdC2	ferredoxin C 2, 2Fe-2S ferredo...		Potri.008G153200 [exp]	6.92	0.9518
AT1G74070			Cyclophilin-like peptidyl-prol...		Potri.012G058700 [exp]	8.66	0.9407
AT1G60550		ECHID, DHNS	enoyl-CoA hydratase/isomerase ...		Potri.001G329900 [exp]	9.16	0.9303
AT5G43940		PAR2, ATGSNOR1,...	PARAQUAT RESISTANT 2, sensitiv...		Potri.002G254900 [exp]	9.59	0.8769	FDH1
AT1G05190		EMB2394	embryo defective 2394, Ribosom...		Potri.002G229350 [exp]	10.00	0.8962

Compare expression of checked genes

Potri.003G015200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.