Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G20600 39 / 0.0004 B3 AP2/B3-like transcriptional factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G017566 [exp] 213 / 3e-73 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1) Potri.003G018400 [exp] 209 / 2e-71 ND / Potri.004G218101 [exp] 171 / 1e-56 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1) Potri.014G068000 [exp] 93 / 1e-25 AT1G68840 47 / 5e-07 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2) Potri.014G067900 [exp] 85 / 2e-22 AT4G01500 42 / 2e-05 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G013700 [exp] 79 / 7e-20 AT4G01500 52 / 6e-09 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015501 [exp] 79 / 7e-20 AT1G13260 46 / 1e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.015G015650 [exp] 78 / 1e-19 AT1G13260 50 / 6e-08 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.004G220550 [exp] 77 / 2e-19 AT3G25730 44 / 7e-06 ethylene response DNA binding factor 3 (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G015900.1 pacid=42784677 polypeptide=Potri.003G015900.1.p locus=Potri.003G015900 ID=Potri.003G015900.1.v4.1 annot-version=v4.1 ATGCAGATCTTCAGCAAAGTGTTGACAGATACTGATGTTCGTTTTCGGTTCTCGTTCCCAACTCATTGCTTGCAGCATTTAGATTTTGCTGGAAATAATT CTGTTGATTTGCATGTTAAAGATAGCTGTGGTGAGCTTCGAGTTATTCGTTGCCGGAAGAGAAATGGAGGTTATGACAAGCCAGAGCTTTCTACGGGCTG GCTTAAATTTGTTGCTGATTATGGACTGAGAGTTGGTGACAAGGTTGTTGTTCATCGTGAGGATGACCATAACCTGGGGTCACAGTTCAGGATTGAAGCT AAGAGGAGTATCAAGCTGTTTGGTGAGGAGGATTGGGGTGAAGTGACAAGAGCTAACTAG
AA sequence Show only first row Show all	>Potri.003G015900.1 pacid=42784677 polypeptide=Potri.003G015900.1.p locus=Potri.003G015900 ID=Potri.003G015900.1.v4.1 annot-version=v4.1 MQIFSKVLTDTDVRFRFSFPTHCLQHLDFAGNNSVDLHVKDSCGELRVIRCRKRNGGYDKPELSTGWLKFVADYGLRVGDKVVVHREDDHNLGSQFRIEA KRSIKLFGEEDWGEVTRAN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.003G015900 [exp]	0	1
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.003G017566 [exp]	1.41	0.9889
AT2G31130			unknown protein		Potri.011G065100 [exp]	6.32	0.9491
AT3G60300			RWD domain-containing protein ...		Potri.014G048000 [exp]	14.28	0.9387
AT1G05680		UGT74E2	Uridine diphosphate glycosyltr...		Potri.007G140700 [exp]	15.00	0.9373
AT1G53430			Leucine-rich repeat transmembr...		Potri.001G386100 [exp]	22.84	0.9158
AT4G04940			transducin family protein / WD...		Potri.018G148132 [exp]	23.45	0.8975
					Potri.006G271586 [exp]	24.53	0.9438
AT5G36930			Disease resistance protein (TI...		Potri.007G143100 [exp]	29.08	0.9436
AT1G78980		SRF5	STRUBBELIG-receptor family 5 (...		Potri.014G001200 [exp]	29.66	0.9606
AT4G05030			Copper transport protein famil...		Potri.016G002600 [exp]	30.16	0.9551

Compare expression of checked genes

Potri.003G015900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.