Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80530 161 / 1e-47 Major facilitator superfamily protein (.1) AT4G34950 96 / 1e-23 Major facilitator superfamily protein (.1) AT2G16660 91 / 3e-22 Major facilitator superfamily protein (.1) AT5G14120 89 / 3e-21 Major facilitator superfamily protein (.1) AT3G01930 88 / 4e-21 Major facilitator superfamily protein (.1.2) AT1G74780 80 / 2e-18 Nodulin-like / Major Facilitator Superfamily protein (.1) AT2G34355 80 / 3e-18 Major facilitator superfamily protein (.1) AT1G18940 79 / 7e-18 Nodulin-like / Major Facilitator Superfamily protein (.1) AT2G39210 77 / 3e-17 Major facilitator superfamily protein (.1) AT2G34350 76 / 8e-17 Nodulin-like / Major Facilitator Superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G204700 [exp] 229 / 1e-73 AT1G80530 625 / 0.0 Major facilitator superfamily protein (.1) Potri.003G012300 [exp] 203 / 1e-63 AT1G80530 650 / 0.0 Major facilitator superfamily protein (.1) Potri.006G060900 [exp] 191 / 4e-59 AT1G80530 632 / 0.0 Major facilitator superfamily protein (.1) Potri.004G173400 [exp] 100 / 1e-25 AT4G34950 682 / 0.0 Major facilitator superfamily protein (.1) Potri.009G132700 [exp] 96 / 1e-23 AT4G34950 661 / 0.0 Major facilitator superfamily protein (.1) Potri.005G112400 [exp] 96 / 1e-23 AT4G34950 618 / 0.0 Major facilitator superfamily protein (.1) Potri.017G064201 [exp] 84 / 2e-19 AT3G01930 805 / 0.0 Major facilitator superfamily protein (.1.2) Potri.012G098900 [exp] 78 / 1e-17 AT5G14120 681 / 0.0 Major facilitator superfamily protein (.1) Potri.001G329100 [exp] 77 / 2e-17 AT3G01930 869 / 0.0 Major facilitator superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041962 [exp] 192 / 3e-59 AT1G80530 715 / 0.0 Major facilitator superfamily protein (.1) Lus10017480 [exp] 189 / 2e-58 AT1G80530 702 / 0.0 Major facilitator superfamily protein (.1) Lus10017971 [exp] 189 / 6e-58 AT1G80530 716 / 0.0 Major facilitator superfamily protein (.1) Lus10028803 [exp] 188 / 8e-58 AT1G80530 707 / 0.0 Major facilitator superfamily protein (.1) Lus10001678 [exp] 163 / 2e-48 AT1G80530 649 / 0.0 Major facilitator superfamily protein (.1) Lus10030112 [exp] 113 / 7e-32 AT1G80530 224 / 4e-70 Major facilitator superfamily protein (.1) Lus10025053 [exp] 106 / 2e-27 AT4G34950 793 / 0.0 Major facilitator superfamily protein (.1) Lus10034491 [exp] 100 / 2e-25 AT4G34950 788 / 0.0 Major facilitator superfamily protein (.1) Lus10032034 [exp] 84 / 1e-19 AT3G01930 874 / 0.0 Major facilitator superfamily protein (.1.2) Lus10035203 [exp] 84 / 1e-19 AT3G01930 876 / 0.0 Major facilitator superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G016725.1 pacid=42786320 polypeptide=Potri.003G016725.1.p locus=Potri.003G016725 ID=Potri.003G016725.1.v4.1 annot-version=v4.1 ATGCTCATAACCTTGTTTCCTTTTTCGTTGGCTCTTAATGGAATTCTTTATGCTGCAATTCCTCTTCTTGGCATCTGCTACGGGATTTTCTATGATATAA TGGTGCCGCCTGCTTCCGAGCTTTTTGGCTTGAAACATTTTGGTTTGATTTACAGCTCCATGGGGCTAGGCAATCCTACTGGTGCGCTTCTTGTCTCAGG TTTGCTTGCTGGTTATGCATATGATGCTGAAGCTGCTAAGCAAGATAGCTCTGCTTGTGTTGGTCATGATTGCTTCGAGGTGACATTCCTGGTTCTAGCT GGTGTCTGTGGGTTGGGGACAATCTTGAGCATAATTTTGACAGTTAGAATTCGGCCAGTTTACCAACTACTTTATTCAGGGGGTTCTTTCCGTCTGCCTC AAACACCCGGCCATTGA
AA sequence Show only first row Show all	>Potri.003G016725.1 pacid=42786320 polypeptide=Potri.003G016725.1.p locus=Potri.003G016725 ID=Potri.003G016725.1.v4.1 annot-version=v4.1 MLITLFPFSLALNGILYAAIPLLGICYGIFYDIMVPPASELFGLKHFGLIYSSMGLGNPTGALLVSGLLAGYAYDAEAAKQDSSACVGHDCFEVTFLVLA GVCGLGTILSIILTVRIRPVYQLLYSGGSFRLPQTPGH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G80530			Major facilitator superfamily ...		Potri.003G016725 [exp]	0	1
AT5G63690			Nucleic acid-binding, OB-fold-...		Potri.014G083500 [exp]	3.00	0.7819
AT5G36930			Disease resistance protein (TI...		Potri.005G003900 [exp]	4.47	0.8004
AT5G09270			unknown protein		Potri.005G066900 [exp]	6.00	0.7638
AT4G14420			HR-like lesion-inducing protei...		Potri.002G040900 [exp]	8.24	0.7320
AT2G23090			Uncharacterised protein family...		Potri.001G296600 [exp]	8.36	0.7701
AT3G55550			Concanavalin A-like lectin pro...		Potri.006G144850 [exp]	11.18	0.7170
AT2G17030			F-box family protein with a do...		Potri.001G277400 [exp]	11.61	0.7603
AT5G60230		ATSEN2, SEN2	splicing endonuclease 2 (.1.2)		Potri.009G131500 [exp]	12.96	0.7625	Pt-SEN1.2
AT1G12700		RPF1	RNA processing factor 1, ATP b...		Potri.005G050400 [exp]	15.29	0.7482
AT5G05330			HMG-box (high mobility group) ...		Potri.019G049100 [exp]	15.55	0.7533

Compare expression of checked genes

Potri.003G016725 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.