Potri.003G016733 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G01500 40 / 0.0002 B3 NGA4 NGATHA4, AP2/B3-like transcriptional factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G013026 257 / 5e-90 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Potri.003G013601 256 / 9e-90 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Potri.003G021250 248 / 2e-86 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Potri.003G011875 236 / 1e-81 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Potri.003G014750 229 / 3e-79 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Potri.004G221300 85 / 6e-22 AT4G01500 48 / 4e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1)
Potri.004G219800 84 / 1e-21 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Potri.004G221600 81 / 1e-20 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Potri.004G219450 81 / 2e-20 AT1G13260 45 / 4e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0405 DNA_b-psBarrel PF02362 B3 B3 DNA binding domain
Representative CDS sequence
>Potri.003G016733.1 pacid=42785690 polypeptide=Potri.003G016733.1.p locus=Potri.003G016733 ID=Potri.003G016733.1.v4.1 annot-version=v4.1
ATGGAACCAGTACATCTCTTCAAGAAGAAACTAAAACCATCCCACATAAGCCATGCTCTTTCAATTCCAACCCATGCCCTTGAGGCTTTTCCAATTCCTG
AAGGAGCCCATATGATGAATTTTGAAGCAGACGATGCTACTGATCATGCATGGAGGTTTTGTCTCTCAACCCGTATGACTGGAGCTTACCCAAAACCCGT
TCTTCTACGCTCTTCTTGGCATCGTTTTGTAGAGCAGAAAGGCCTTGCTCCCGAAGACAGGGTTGTCTTCTTCATGGAGAGAGATGAAGCTAATGACATG
ATCAGGAGGTACACGGTTAGAGCTCAACGAAAAGTGATGACCTTGATGGGGCAAGATGTTTGGGTCGATGTCGAGGATCTTCCCCTATATGGTCTTTGA
AA sequence
>Potri.003G016733.1 pacid=42785690 polypeptide=Potri.003G016733.1.p locus=Potri.003G016733 ID=Potri.003G016733.1.v4.1 annot-version=v4.1
MEPVHLFKKKLKPSHISHALSIPTHALEAFPIPEGAHMMNFEADDATDHAWRFCLSTRMTGAYPKPVLLRSSWHRFVEQKGLAPEDRVVFFMERDEANDM
IRRYTVRAQRKVMTLMGQDVWVDVEDLPLYGL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G53310 B3 REM20 AP2/B3-like transcriptional fa... Potri.003G016733 0 1
AT1G76690 OPR2, ATOPR2 ARABIDOPSIS 12-OXOPHYTODIENOAT... Potri.013G102700 2.00 0.8328
AT2G46600 Calcium-binding EF-hand family... Potri.014G101700 10.00 0.8349
AT3G43540 Protein of unknown function (D... Potri.006G217700 11.40 0.7998
AT4G14880 OLD3, CYTACS1, ... ONSET OF LEAF DEATH 3, O-acety... Potri.008G153300 16.79 0.8304
AT1G42960 unknown protein Potri.005G099233 20.44 0.7868
AT3G27970 Exonuclease family protein (.1... Potri.017G073300 28.91 0.7789
AT1G76430 PHT1;9 phosphate transporter 1;9 (.1) Potri.005G256100 29.66 0.8212 11
AT1G12990 beta-1,4-N-acetylglucosaminylt... Potri.008G186000 31.81 0.8019
AT1G02260 Divalent ion symporter (.1) Potri.017G141700 31.93 0.8165
AT1G56300 Chaperone DnaJ-domain superfam... Potri.005G020300 41.18 0.7244

Potri.003G016733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.