Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64080 121 / 4e-35 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G13820 115 / 2e-33 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G08670 80 / 9e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 78 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G36150 79 / 4e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 72 / 5e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 67 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 61 / 7e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44290 58 / 2e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 57 / 4e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G210100 [exp] 173 / 1e-55 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G169000 [exp] 91 / 6e-23 AT5G64080 86 / 7e-21 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.002G092800 [exp] 85 / 1e-20 AT5G64080 84 / 3e-20 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155100 [exp] 67 / 4e-14 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 66 / 6e-14 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G158100 [exp] 60 / 3e-11 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085300 [exp] 54 / 4e-09 AT3G22600 66 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 54 / 4e-09 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232000 [exp] 54 / 5e-09 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021604 [exp] 119 / 5e-34 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10041197 [exp] 77 / 8e-18 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 76 / 2e-17 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 71 / 1e-15 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 69 / 6e-15 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10008400 [exp] 67 / 2e-14 AT3G43720 76 / 6e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026768 [exp] 66 / 5e-14 AT2G27130 81 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 65 / 4e-13 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042611 [exp] 62 / 4e-12 AT3G22600 142 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10001153 [exp] 60 / 4e-11 AT3G43720 105 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.003G020200.1 pacid=42786143 polypeptide=Potri.003G020200.1.p locus=Potri.003G020200 ID=Potri.003G020200.1.v4.1 annot-version=v4.1 ATGGCATCAAAAAAGGTGTTGTCTTTGATCCTTCTCTGCACAATCTCAGTCTCTTGTTGTATCTGGGCAGAGGGTGCCTCCCACCGCCACGCCTCAGCCC CAGCACCCTCAGTGGACTGCACCACTCTGGTGCTGAGCATGGCTGACTGCTTGTCGTTTGTGTCGAACGACAGCACTTCAAAAAAGCCAGAAGGGACTTG CTGTTCTGGTTTGAAAACGGTGCTGGGCACTGACGCTGAGTGCCTCTGTGAGGCCTTCAAGAGCAGTGCTCAATTTGGTGTCGTCTTGAATGTCACTAAG GCTCTAGCTCTCCCTTCTGCTTGCAAAATCAAAGCCCCTCCTGCGTCTAACTGCGGATTGACCACACCTAGCCCTGCTGGTGCCCCTGCAGGATCTGCTG CAGCCGGACCGTCTGTGAATGGTGTATCCAATGAGCTAGCACCAGCTCCGTCTCCAGGTTCTTCCGGTTCTAATGGATTATTTGTCTCTGCCGGATCTTT AATCGTCGGACTTGTAGTTGCATCTTTCTCTAGTTTCTGA
AA sequence Show only first row Show all	>Potri.003G020200.1 pacid=42786143 polypeptide=Potri.003G020200.1.p locus=Potri.003G020200 ID=Potri.003G020200.1.v4.1 annot-version=v4.1 MASKKVLSLILLCTISVSCCIWAEGASHRHASAPAPSVDCTTLVLSMADCLSFVSNDSTSKKPEGTCCSGLKTVLGTDAECLCEAFKSSAQFGVVLNVTK ALALPSACKIKAPPASNCGLTTPSPAGAPAGSAAAGPSVNGVSNELAPAPSPGSSGSNGLFVSAGSLIVGLVVASFSSF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64080		AtXYP1	xylogen protein 1, Bifunctiona...		Potri.003G020200 [exp]	0	1
AT1G79760		DTA4	downstream target of AGL15-4 (...		Potri.001G189400 [exp]	1.00	0.9621	DTA4.1
AT5G51560			Leucine-rich repeat protein ki...		Potri.012G128700 [exp]	2.82	0.9328
AT5G67260		CYCD3;2	CYCLIN D3;2 (.1)		Potri.005G141900 [exp]	2.82	0.9252	CYCD3.4
AT5G15350		AtENODL17	early nodulin-like protein 17 ...		Potri.001G043600 [exp]	3.00	0.9262
AT5G02420			unknown protein		Potri.001G239000 [exp]	5.47	0.8796
AT1G47670			Transmembrane amino acid trans...		Potri.014G036500 [exp]	5.47	0.9226
AT4G21450			PapD-like superfamily protein ...		Potri.013G147800 [exp]	5.91	0.9245
AT3G05030		ATNHX2, NHX2	sodium hydrogen exchanger 2 (....		Potri.010G031500 [exp]	6.00	0.9049	Pt-NHX1.1
AT3G54030			Protein kinase protein with te...		Potri.016G105800 [exp]	7.00	0.9217
AT2G21050		LAX2	like AUXIN RESISTANT 2 (.1)		Potri.009G132100 [exp]	7.48	0.9032	PtrAUX6,Pt-LAX5.1

Compare expression of checked genes

Potri.003G020200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.