Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15820 421 / 9e-151 CP24, LHCB6 light harvesting complex photosystem II subunit 6 (.1) AT1G45474 132 / 1e-37 LHCA5 photosystem I light harvesting complex gene 5 (.1.2) AT1G19150 130 / 9e-37 LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA2*1, LHCA6, LHCA2*1, LHCA2*1, LHCA2*1, LH photosystem I light harvesting complex gene 6 (.1) AT3G61470 125 / 1e-34 LHCA2 photosystem I light harvesting complex gene 2 (.1) AT5G01530 111 / 5e-29 LHCB4.1 light harvesting complex photosystem II (.1) AT3G47470 110 / 5e-29 CAB4, LHCA4 light-harvesting chlorophyll-protein complex I subunit A4 (.1) AT3G08940 108 / 3e-28 LHCB4.2 light harvesting complex photosystem II (.1.2) AT2G40100 107 / 1e-27 LHCB4.3 light harvesting complex photosystem II (.1.2) AT1G61520 106 / 3e-27 LHCA3*1, LHCA3*1, LHCA3*1 photosystem I light harvesting complex gene 3 (.1.2.3) AT3G54890 101 / 9e-26 LHCA1 photosystem I light harvesting complex gene 1 (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G210000 [exp] 478 / 2e-173 AT1G15820 424 / 7e-152 light harvesting complex photosystem II subunit 6 (.1) Potri.014G029700 [exp] 133 / 9e-38 AT1G45474 306 / 3e-105 photosystem I light harvesting complex gene 5 (.1.2) Potri.006G139600 [exp] 132 / 3e-37 AT1G19150 393 / 1e-139 photosystem I light harvesting complex gene 6 (.1) Potri.003G171500 [exp] 131 / 5e-37 AT3G61470 409 / 5e-146 photosystem I light harvesting complex gene 2 (.1) Potri.001G056700 [exp] 130 / 2e-36 AT3G61470 410 / 3e-146 photosystem I light harvesting complex gene 2 (.1) Potri.006G099500 [exp] 106 / 2e-27 AT3G08940 474 / 7e-171 light harvesting complex photosystem II (.1.2) Potri.015G062200 [exp] 105 / 3e-27 AT3G47470 442 / 2e-159 light-harvesting chlorophyll-protein complex I subunit A4 (.1) Potri.008G067300 [exp] 105 / 4e-27 AT2G40100 420 / 7e-150 light harvesting complex photosystem II (.1.2) Potri.016G115200 [exp] 105 / 4e-27 AT3G08940 449 / 4e-161 light harvesting complex photosystem II (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015834 [exp] 416 / 5e-149 AT1G15820 393 / 7e-140 light harvesting complex photosystem II subunit 6 (.1) Lus10015831 [exp] 402 / 9e-144 AT1G15820 384 / 2e-136 light harvesting complex photosystem II subunit 6 (.1) Lus10020415 [exp] 399 / 7e-138 AT1G15820 379 / 9e-130 light harvesting complex photosystem II subunit 6 (.1) Lus10020418 [exp] 269 / 3e-92 AT1G15820 247 / 1e-83 light harvesting complex photosystem II subunit 6 (.1) Lus10042657 [exp] 145 / 3e-42 AT1G45474 371 / 3e-131 photosystem I light harvesting complex gene 5 (.1.2) Lus10021730 [exp] 142 / 3e-41 AT1G45474 369 / 2e-130 photosystem I light harvesting complex gene 5 (.1.2) Lus10006416 [exp] 129 / 1e-35 AT3G61470 404 / 6e-144 photosystem I light harvesting complex gene 2 (.1) Lus10011361 [exp] 127 / 4e-35 AT3G61470 414 / 6e-148 photosystem I light harvesting complex gene 2 (.1) Lus10039912 [exp] 125 / 9e-35 AT1G19150 362 / 2e-127 photosystem I light harvesting complex gene 6 (.1) Lus10021663 [exp] 114 / 2e-30 AT3G47470 434 / 2e-156 light-harvesting chlorophyll-protein complex I subunit A4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00504 [poplar] [flax] Chloroa_b-bind Chlorophyll A-B binding protein
Representative CDS sequence Show only first row Show all	>Potri.003G020400.3 pacid=42785376 polypeptide=Potri.003G020400.3.p locus=Potri.003G020400 ID=Potri.003G020400.3.v4.1 annot-version=v4.1 ATGGCTGCTGCCTCCGGTGCTGTCCTAAATGGATTGGGATCTTCGTTCTTGTGTGGAGGGAAGAGGAGTCGAGCCTTGTCGGGAATTGGAGCAACTGGGA TTGGAAGTTGCTCAGTTGGTGCGAGGAAGTTGACGATAGTAGCTGCTGCTCAACCAAAGAAGTCTTGGATCCCTGCTGTTAAAGGTGGTGGCAGCTTCGT TGACCCCGAGTGGCTCGACGGCTCGCTCCCTGGTGACTACGGTTTCGATCCTCTAGGCCTAGGCAAGGACCCTGCATTCCTCAAATGGTACAGGGAAGCT GAACTCATTCACGGCCGGTGGGCTATGGCTGCCGTGGTGGGTATCTTTGTTGGCCAAGCATGGAGCGGCATCCCCTGGTTCGAGGCTGGTGCTGACCCTG GTGCCATCGCACCCTTCTCCTTCGGTTCCCTCCTCGGCACCCAGCTCATTCTCATGGGTTGGGTGGAGAGCAAGCGGTGGGTGGATTTCTTCAACCCCGA GTCCCAATCCGTGGAATGGGCAACACCGTGGTCTAAAACTGCAGAGAACTTCGCCAACGCCACTGGCGACCAGGGTTACCCTGGCGGCAAGTTCTTTGAC CCTCTGGGCTTTGCAGGGACTCTCAAGAATGGAGTGTACATTCCTGATGAGGAGAAGCTCGAGAGACTTAAACTTGCTGAGATTAAGCATGCTAGGCTTG CCATGATTGCCATGTTGATCTTCTACTTTGAGGCTGGTCAAGGCAAGACTCCTCTTGGTGCACTAGGACTGTAA
AA sequence Show only first row Show all	>Potri.003G020400.3 pacid=42785376 polypeptide=Potri.003G020400.3.p locus=Potri.003G020400 ID=Potri.003G020400.3.v4.1 annot-version=v4.1 MAAASGAVLNGLGSSFLCGGKRSRALSGIGATGIGSCSVGARKLTIVAAAQPKKSWIPAVKGGGSFVDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREA ELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLILMGWVESKRWVDFFNPESQSVEWATPWSKTAENFANATGDQGYPGGKFFD PLGFAGTLKNGVYIPDEEKLERLKLAEIKHARLAMIAMLIFYFEAGQGKTPLGALGL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Potri.003G020400 [exp]	0	1
AT5G54270		LHCB3*1, LHCB3*...	light-harvesting chlorophyll B...		Potri.001G407100 [exp]	1.00	0.9887	Lhcb3-1,LHCB3.2
AT1G52827		ATCDT1	cadmium tolerance 1 (.1)		Potri.001G177333 [exp]	2.44	0.9830
AT4G34530	bHLH	bHLH063, CIB1	cryptochrome-interacting basic...		Potri.005G121850 [exp]	3.74	0.9706
AT2G14830			Regulator of Vps4 activity in ...		Potri.011G122800 [exp]	3.74	0.9736
AT2G06510		ATRPA70A, ATRPA...	ARABIDOPSIS THALIANA RPA70-KDA...		Potri.018G065300 [exp]	4.00	0.9842
AT5G54270		LHCB3*1, LHCB3*...	light-harvesting chlorophyll B...		Potri.011G126700 [exp]	4.47	0.9753
AT4G39230			NmrA-like negative transcripti...		Potri.013G104000 [exp]	4.47	0.9770
AT1G75690		LQY1	LOW QUANTUM YIELD OF PHOTOSYST...		Potri.002G023600 [exp]	4.89	0.9728
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Potri.011G079500 [exp]	6.48	0.9748	Lhcb1-1,Pt-LHB1.2
AT1G64720		CP5	Polyketide cyclase/dehydrase a...		Potri.001G450100 [exp]	6.92	0.9647

Compare expression of checked genes

Potri.003G020400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.