Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26070 244 / 6e-81 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT3G26080 221 / 1e-71 plastid-lipid associated protein PAP / fibrillin family protein (.1) AT5G19940 64 / 1e-11 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) AT3G23400 60 / 3e-10 FIB4 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT4G00030 56 / 3e-09 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT1G51110 54 / 4e-08 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT4G04020 52 / 2e-07 FIB fibrillin (.1) AT4G22240 49 / 1e-06 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT2G35490 45 / 3e-05 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G209600 [exp] 284 / 3e-96 AT3G26070 253 / 7e-85 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.008G169100 [exp] 69 / 4e-13 AT3G23400 267 / 2e-89 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.006G276400 [exp] 61 / 8e-11 AT5G19940 279 / 2e-95 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) Potri.001G011700 [exp] 59 / 8e-10 AT1G51110 532 / 0.0 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.014G058400 [exp] 58 / 1e-09 AT4G00030 282 / 2e-97 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.004G003200 [exp] 56 / 1e-08 AT4G22240 380 / 1e-132 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.001G137900 [exp] 56 / 1e-08 AT2G35490 301 / 3e-100 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.003G095900 [exp] 55 / 3e-08 AT2G35490 334 / 5e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.001G309300 [exp] 53 / 5e-08 AT5G09820 268 / 7e-90 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020982 [exp] 278 / 8e-94 AT3G26070 265 / 1e-89 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10021209 [exp] 72 / 4e-14 AT3G23400 305 / 4e-104 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10011803 [exp] 70 / 1e-13 AT3G23400 307 / 5e-105 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10010444 [exp] 66 / 4e-12 AT1G51110 490 / 2e-173 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10020860 [exp] 64 / 1e-11 AT5G09820 269 / 5e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) Lus10033514 [exp] 63 / 2e-11 AT5G09820 270 / 3e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) Lus10020912 [exp] 62 / 3e-11 AT4G00030 276 / 2e-94 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10012100 [exp] 63 / 7e-11 AT1G51110 511 / 0.0 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10026221 [exp] 61 / 2e-10 AT5G19940 276 / 4e-94 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) Lus10035384 [exp] 56 / 1e-08 AT2G35490 357 / 5e-122 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04755 [poplar] [flax] PAP_fibrillin PAP_fibrillin
Representative CDS sequence Show only first row Show all	>Potri.003G020700.3 pacid=42786306 polypeptide=Potri.003G020700.3.p locus=Potri.003G020700 ID=Potri.003G020700.3.v4.1 annot-version=v4.1 ATGCTGTTTATCTTTTCTCCTTCGTCCACAACCAGAACGAGCTACCTTGAAAACAAAGAAAACAGAGAAGAGAGACAGCCTTCGGTACTGCAGAGTAGCG TTCATCTCCACCTCGCTCCACCGCTAATGGCCATGTTTTCTTGTTCAGCTAGGCCTACTAAGCTATATGCTGCTCTTCCTCTTCCCCCAGCCAAACATGG CACTTCTCATCATTCTATAATGCTCACATTTCCCTCATCTTCAAAACCCAAAAAGAATAATTCTCGCGTAGGCATAGACTTATTATCAAGCTCCAACAAC AACCCTGATGATTCTTGGGGATATTGGAGGACCAACGTTTCCTTCTTTCAATTTTTTTCAGCCAAAAGTAAAGATGTAAAGAGCCTTAAACAGCAACTTC TTGAGGCAATAGCGCCTCTTGATCGGGGTGCTGTGGCTACCCCTCAGGACCAAAAACGCGTTGATGAGATTGCTCAGGAACTTGAGGCTGTGAATGATAT AAAGGAGCCATTCAAGTCAAATCTTCTGAATGGGAAATGGGAGCTTTTATATACAACATCTCAATCAATTCTTAAAACAAAGAGACCAAAGTTCTTGAGA CCAAATGGAAAAATCTACCAGGCAATTAATGCGGATACTTTAAGGGCTCAAAATATGGAAACTTGGCCCTTCTTTAACCAGGCCACCGCTAATTTAGTGC CTCTAAACACAAGAAGGGTAGCTGTTAAATTTGACTTCTTCAGAATTGCAGGTCTGATACCTATTAAATCACCTGGAAGTGGCCGTGGTCAATTGGAAAT CACCTACTTGGATGAGGAGTTGCGAATATCAAGGGGTGATAGAGGAAATTTGTTCGTTCTGAAAATGGCGGATCCATCTTACAGAGTCCCTCTCTAA
AA sequence Show only first row Show all	>Potri.003G020700.3 pacid=42786306 polypeptide=Potri.003G020700.3.p locus=Potri.003G020700 ID=Potri.003G020700.3.v4.1 annot-version=v4.1 MLFIFSPSSTTRTSYLENKENREERQPSVLQSSVHLHLAPPLMAMFSCSARPTKLYAALPLPPAKHGTSHHSIMLTFPSSSKPKKNNSRVGIDLLSSSNN NPDDSWGYWRTNVSFFQFFSAKSKDVKSLKQQLLEAIAPLDRGAVATPQDQKRVDEIAQELEAVNDIKEPFKSNLLNGKWELLYTTSQSILKTKRPKFLR PNGKIYQAINADTLRAQNMETWPFFNQATANLVPLNTRRVAVKFDFFRIAGLIPIKSPGSGRGQLEITYLDEELRISRGDRGNLFVLKMADPSYRVPL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G26070			Plastid-lipid associated prote...		Potri.003G020700 [exp]	0	1
AT2G18940			Tetratricopeptide repeat (TPR)...		Potri.006G166200 [exp]	3.31	0.9653
AT5G58140		NPL1, PHOT2	NON PHOTOTROPIC HYPOCOTYL 1-LI...		Potri.004G209700 [exp]	4.00	0.9574
AT1G58440		SQE1, XF1	SQUALENE EPOXIDASE 1, FAD/NAD(...		Potri.019G014376 [exp]	6.63	0.9494
AT5G49920			Octicosapeptide/Phox/Bem1p fam...		Potri.003G006200 [exp]	6.85	0.9338
					Potri.003G135200 [exp]	7.93	0.9516
AT3G11420			Protein of unknown function (D...		Potri.010G199900 [exp]	8.00	0.9539
AT4G08920		OOP2, HY4, BLU1...	OUT OF PHASE 2, ELONGATED HYPO...		Potri.005G164700 [exp]	9.16	0.9553	CRY1.1
AT1G16880		ACR11	ACT domain repeats 11, uridyly...		Potri.008G010400 [exp]	9.48	0.9568
AT4G32320		APX6	ascorbate peroxidase 6 (.1)		Potri.006G254500 [exp]	10.29	0.9613
AT1G79080			Pentatricopeptide repeat (PPR)...		Potri.001G457300 [exp]	12.72	0.9597

Compare expression of checked genes

Potri.003G020700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.