Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26410 134 / 2e-38 TRM11, AtTRM11 tRNA modification 11, methyltransferases;nucleic acid binding (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G207000 [exp] 155 / 1e-46 AT3G26410 695 / 0.0 tRNA modification 11, methyltransferases;nucleic acid binding (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018149 [exp] 154 / 4e-46 AT3G26410 731 / 0.0 tRNA modification 11, methyltransferases;nucleic acid binding (.1) Lus10025686 [exp] 145 / 1e-43 AT3G26410 540 / 0.0 tRNA modification 11, methyltransferases;nucleic acid binding (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF01170 [poplar] [flax] UPF0020 Putative RNA methylase family UPF0020
Representative CDS sequence Show only first row Show all	>Potri.003G022650.1 pacid=42786040 polypeptide=Potri.003G022650.1.p locus=Potri.003G022650 ID=Potri.003G022650.1.v4.1 annot-version=v4.1 ATGGAAACCGATGACTATGGAGCTCACAATGGGCTTCCGCCGGTCGTCCAAAGAAGAATCTTTTTTGGTCGACAAGTTGGTGGTGCTGACAGGAAGCTCT TACCAACTTATCCATTTAAAAGCCGCAAGTACCTCGGCCCAGCAACTCTGGGTGCAGAGATGGCTTTCTTGATGGCCAACCAAGCACATGTCACCCCAGG GAAAGTCGTCTATGATCCTTTTGTTGGATCTGGCAGCATTCTCATTGCTGCAGCTCACTTTGGGGCAATCACACCATGGTTTGCGTTTTATTGCCCTTTT CTTTCATGTTAA
AA sequence Show only first row Show all	>Potri.003G022650.1 pacid=42786040 polypeptide=Potri.003G022650.1.p locus=Potri.003G022650 ID=Potri.003G022650.1.v4.1 annot-version=v4.1 METDDYGAHNGLPPVVQRRIFFGRQVGGADRKLLPTYPFKSRKYLGPATLGAEMAFLMANQAHVTPGKVVYDPFVGSGSILIAAAHFGAITPWFAFYCPF LSC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G26410		TRM11, AtTRM11	tRNA modification 11, methyltr...		Potri.003G022650 [exp]	0	1
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.003G017566 [exp]	23.06	0.8804
AT5G49580			Chaperone DnaJ-domain superfam...		Potri.008G101800 [exp]	31.41	0.8217
AT1G03090		MCCA	methylcrotonyl-CoA carboxylase...		Potri.005G213300 [exp]	32.55	0.8600	MCCA.1
AT2G47940		EMB3117, DEGP2	EMBRYO DEFECTIVE 3117, DEGP pr...		Potri.002G207200 [exp]	63.48	0.8195
AT2G47980		SCC3, ATSCC3	sister-chromatid cohesion prot...		Potri.014G151400 [exp]	96.14	0.8267
AT1G17960			Threonyl-tRNA synthetase (.1)		Potri.010G096550 [exp]	97.85	0.8200
AT5G27550			P-loop containing nucleoside t...		Potri.005G031801 [exp]	160.49	0.8135
AT5G49360		ATBXL1, BXL1	beta-xylosidase 1 (.1)		Potri.010G141400 [exp]	172.96	0.7971	Pt-BXL1.2
					Potri.007G061801 [exp]	197.29	0.8045
AT4G04940			transducin family protein / WD...		Potri.018G148132 [exp]	241.49	0.8029

Compare expression of checked genes

Potri.003G022650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.