Potri.003G022701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26410 96 / 8e-25 TRM11, AtTRM11 tRNA modification 11, methyltransferases;nucleic acid binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G207000 139 / 6e-41 AT3G26410 695 / 0.0 tRNA modification 11, methyltransferases;nucleic acid binding (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025686 104 / 2e-28 AT3G26410 540 / 0.0 tRNA modification 11, methyltransferases;nucleic acid binding (.1)
Lus10018149 103 / 3e-27 AT3G26410 731 / 0.0 tRNA modification 11, methyltransferases;nucleic acid binding (.1)
Lus10018147 50 / 1e-08 AT3G26410 206 / 2e-62 tRNA modification 11, methyltransferases;nucleic acid binding (.1)
PFAM info
Representative CDS sequence
>Potri.003G022701.3 pacid=42784965 polypeptide=Potri.003G022701.3.p locus=Potri.003G022701 ID=Potri.003G022701.3.v4.1 annot-version=v4.1
ATGGGTGGCAGGCTTGTATGCTTTTACCCTGTATTGAGAGAAGATGACGTGGAAAATCACTTTCCAGAGCACCCATGTTTGAAATTGATAGTGTCCTCTG
AACAGATTCCAAGTTCACGTTACAGCCAGGTATTACTAACCATAGTGAAGACAGTTTCATACACCGACAAAATCGCTGAGGCAGCCAAGATCAAGCACCA
GGAGTTCAAGGAGAATTATGTGAAGTGTGAAACGATCGTGAAGATCTAA
AA sequence
>Potri.003G022701.3 pacid=42784965 polypeptide=Potri.003G022701.3.p locus=Potri.003G022701 ID=Potri.003G022701.3.v4.1 annot-version=v4.1
MGGRLVCFYPVLREDDVENHFPEHPCLKLIVSSEQIPSSRYSQVLLTIVKTVSYTDKIAEAAKIKHQEFKENYVKCETIVKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G26410 TRM11, AtTRM11 tRNA modification 11, methyltr... Potri.003G022701 0 1
Potri.012G036400 4.58 0.7703
AT2G02710 PLPC, PLPB, PLP... PAS/LOV PROTEIN C, PAS/LOV PRO... Potri.010G053500 5.29 0.7639
AT3G15690 Single hybrid motif superfamil... Potri.003G061400 7.48 0.7146
AT1G80080 AtRLP17, TMM TOO MANY MOUTHS, Receptor Like... Potri.001G202100 8.48 0.6894
AT4G13590 Uncharacterized protein family... Potri.003G174600 8.94 0.7821
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Potri.005G007750 9.79 0.7324
AT2G41720 EMB2654 EMBRYO DEFECTIVE 2654, Tetratr... Potri.006G049900 12.04 0.7395
AT3G14172 unknown protein Potri.013G091900 12.84 0.6754
AT3G60510 ATP-dependent caseinolytic (Cl... Potri.014G057400 13.41 0.6589
AT1G68640 bZIP PAN PERIANTHIA, bZIP transcription... Potri.010G128001 15.87 0.7218

Potri.003G022701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.