Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	NAC118
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G64530 231 / 4e-78 NAC ANAC104, XND1 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) AT3G15510 116 / 3e-31 NAC ATNAC2, ANAC056, NARS1 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) AT1G61110 113 / 3e-30 NAC ANAC025 NAC domain containing protein 25 (.1) AT4G27410 111 / 8e-30 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT1G01720 106 / 5e-28 NAC ATAF1, ANAC002 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G52890 105 / 2e-27 NAC ANAC019 NAC domain containing protein 19 (.1) AT3G15500 104 / 3e-27 NAC ATNAC3, ANAC055 NAC domain containing protein 55, NAC domain containing protein 3 (.1) AT3G04070 105 / 4e-27 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT1G26870 104 / 2e-26 NAC FEZ, ANAC009 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G77450 100 / 4e-26 NAC ANAC032 NAC domain containing protein 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G206900 [exp] 288 / 9e-101 AT5G64530 221 / 2e-74 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.005G064100 [exp] 197 / 2e-64 AT5G64530 199 / 3e-65 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.007G105000 [exp] 190 / 1e-61 AT5G64530 183 / 3e-59 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Potri.004G038000 [exp] 127 / 1e-35 AT1G61110 332 / 3e-113 NAC domain containing protein 25 (.1) Potri.011G046700 [exp] 125 / 1e-34 AT1G61110 331 / 8e-113 NAC domain containing protein 25 (.1) Potri.001G404400 [exp] 121 / 3e-33 AT3G15510 345 / 1e-117 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.011G123500 [exp] 118 / 5e-32 AT3G15510 323 / 4e-109 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Potri.013G054000 [exp] 107 / 1e-27 AT3G04070 338 / 9e-115 NAC domain containing protein 47 (.1.2) Potri.011G123300 [exp] 106 / 2e-27 AT4G27410 354 / 2e-122 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000206 [exp] 234 / 3e-79 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10035648 [exp] 234 / 3e-79 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10035647 [exp] 234 / 3e-79 AT5G64530 264 / 5e-91 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10010747 [exp] 231 / 5e-78 AT5G64530 259 / 4e-89 Arabidopsis NAC domain containing protein 104, xylem NAC domain 1 (.1) Lus10011215 [exp] 128 / 1e-35 AT1G61110 305 / 1e-102 NAC domain containing protein 25 (.1) Lus10018469 [exp] 126 / 4e-35 AT1G61110 301 / 5e-101 NAC domain containing protein 25 (.1) Lus10032657 [exp] 123 / 1e-33 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10043095 [exp] 122 / 3e-33 AT3G15510 351 / 1e-119 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10042531 [exp] 118 / 7e-32 AT3G04070 303 / 4e-101 NAC domain containing protein 47 (.1.2) Lus10003269 [exp] 113 / 8e-30 AT3G04070 324 / 3e-109 NAC domain containing protein 47 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.003G022800.1 pacid=42784674 polypeptide=Potri.003G022800.1.p locus=Potri.003G022800 ID=Potri.003G022800.1.v4.1 annot-version=v4.1 ATGGCTGCCAATCTTCCTCCTGGTTTTCGATTTTGTCCAAGTGATGAAGAGCTTGTAGTGCATTTTCTTCATCGTAAAGCAGCTCTTTTACCTTGCCACC CAGATGTCATCCCGGATCTTGATCTTTATCCTTATGATCCATGGGAACTTGATGGTAAGGCATTGTCGGAGGGTAAACAATGCTACTTCTATAGCCGAAG AACACAAAACAGGATTACTAATAACGGGTGCTGGAAGCCAATGGTTGGCCACGTTGAAGAACCTATACTTGCAAGTGAGAACAACAAACTAGTTGGGATC AAGAAATATTTTATATTTTATGCAGCAGAAGGCATCAAAACTAATTGGATAATGGAAGAGTACCTTCTCTCGGAACATCGCACCTCTCATGACTCTTCTC CCTCTACTAAATCATCCAAAACCAGAGCCCGTTCAAAGCAAGATTATAGTAAATGGGTTATTTGTCGGGTCTATGAGCGGAGTTATGAGGAGGAGGAGGA TGGAGGAAAGGAACTGTCATGTCTAGACGAAGTTTTCTTATCATTGGAGGATCTTGATGAAATAAGCTTGCCAAATTAA
AA sequence Show only first row Show all	>Potri.003G022800.1 pacid=42784674 polypeptide=Potri.003G022800.1.p locus=Potri.003G022800 ID=Potri.003G022800.1.v4.1 annot-version=v4.1 MAANLPPGFRFCPSDEELVVHFLHRKAALLPCHPDVIPDLDLYPYDPWELDGKALSEGKQCYFYSRRTQNRITNNGCWKPMVGHVEEPILASENNKLVGI KKYFIFYAAEGIKTNWIMEEYLLSEHRTSHDSSPSTKSSKTRARSKQDYSKWVICRVYERSYEEEEDGGKELSCLDEVFLSLEDLDEISLPN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G64530	NAC	ANAC104, XND1	Arabidopsis NAC domain contain...		Potri.003G022800 [exp]	0	1	NAC118
AT1G77855			unknown protein		Potri.019G084400 [exp]	1.41	0.7346
AT1G14600	GARP		Homeodomain-like superfamily p...		Potri.008G142000 [exp]	7.74	0.7222
AT3G63300		FKD1	FORKED 1 (.1.2)		Potri.005G213800 [exp]	14.21	0.7388
AT5G22740		ATCSLA2, ATCSLA...	CELLULOSE SYNTHASE-LIKE A 2, A...		Potri.004G189000 [exp]	15.74	0.7230	Pt-ATCSLA02.2
AT1G68640	bZIP	PAN	PERIANTHIA, bZIP transcription...		Potri.008G118300 [exp]	20.83	0.7058	PAN.2
AT3G51060		SRS1, STY1	STYLISH 1, SHI RELATED SEQUENC...		Potri.007G017500 [exp]	27.87	0.6673
AT5G38530		TSBtype2	tryptophan synthase beta type ...		Potri.017G109600 [exp]	29.79	0.7215
AT3G10330			Cyclin-like family protein (.1...		Potri.015G067500 [exp]	30.00	0.7049	TFIIB1.1
AT3G56950		SIP2;1, SIP2	small and basic intrinsic prot...		Potri.006G027200 [exp]	33.19	0.6831	Pt-SIP2.2
AT2G22900			Galactosyl transferase GMA12/M...		Potri.014G006100 [exp]	40.13	0.7183	GT6.2

Compare expression of checked genes

Potri.003G022800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.