Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14840 105 / 4e-27 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G07650 98 / 1e-24 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G53420 78 / 1e-17 Leucine-rich repeat transmembrane protein kinase (.1) AT1G53430 74 / 3e-16 Leucine-rich repeat transmembrane protein kinase (.1.2) AT1G53440 72 / 2e-15 Leucine-rich repeat transmembrane protein kinase (.1) AT5G65240 62 / 5e-12 Leucine-rich repeat protein kinase family protein (.1.2) AT1G29730 57 / 2e-10 Leucine-rich repeat transmembrane protein kinase (.1) AT1G29720 57 / 2e-10 Leucine-rich repeat transmembrane protein kinase (.1) AT5G10290 55 / 1e-09 leucine-rich repeat transmembrane protein kinase family protein (.1) AT3G05140 55 / 1e-09 RBK2 ROP binding protein kinases 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G386000 [exp] 229 / 2e-78 AT1G07650 193 / 2e-57 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.001G385200 [exp] 233 / 2e-72 AT3G14840 1171 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.011G072941 [exp] 94 / 2e-23 AT1G29720 947 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.011G072741 [exp] 94 / 3e-23 AT1G29740 1014 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.004G063600 [exp] 93 / 5e-23 AT1G07650 479 / 4e-160 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.004G135500 [exp] 93 / 6e-23 AT1G07650 1324 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.011G073191 [exp] 91 / 8e-23 AT1G07650 370 / 1e-120 Leucine-rich repeat transmembrane protein kinase (.1.2) Potri.011G072866 [exp] 92 / 9e-23 AT1G29740 1024 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Potri.019G009700 [exp] 92 / 1e-22 AT3G14840 894 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031374 [exp] 89 / 2e-21 AT1G07650 1221 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10041937 [exp] 69 / 1e-14 AT1G53440 1138 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10005418 [exp] 68 / 4e-14 AT1G29750 800 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10005550 [exp] 66 / 2e-13 AT1G53440 1223 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10015239 [exp] 64 / 1e-12 AT1G29750 1189 / 0.0 receptor-like kinase in flowers 1 (.1.2) Lus10042505 [exp] 63 / 2e-12 AT1G53440 1013 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10038153 [exp] 62 / 4e-12 AT1G53440 1046 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1) Lus10010950 [exp] 58 / 6e-12 AT1G07650 96 / 1e-24 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10004982 [exp] 56 / 7e-10 AT3G53810 664 / 0.0 Concanavalin A-like lectin protein kinase family protein (.1) Lus10000629 [exp] 55 / 1e-09 AT5G10290 914 / 0.0 leucine-rich repeat transmembrane protein kinase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G026150.1 pacid=42785087 polypeptide=Potri.003G026150.1.p locus=Potri.003G026150 ID=Potri.003G026150.1.v4.1 annot-version=v4.1 ATGGCAACAAACCCAACAAAAGGGACTTTGCTGGTGCTTGTTGATCCAAAACTAGGCCAAGACTACAACAAAGAAGAGGTGATAATAATGATTAATGTGG CTCTCCTCTGCAGTAATGTCTCTGCAGCAGTTAGGCCTGCGATGTCTTCAGTAGTAAGCATGCTCGAAGGAAAGGCTGTTGTTCAAGATATTGACATTCC AGATAAAAGCATGTCAACGGATGAGAAGAAGATTGAAGAAATGAGGAGGCATTTTCAAGTTATCAACGAACAGGAAATAAGTGAGACTCGTACTCTGTCA ATGGATGGACCGTCGACTGCTGCTTCTACATCTGCTGGTGATCTTTATCCAGTCTCTTTGGATTCTGACTATTGGAAGGGTAGAGAGTAG
AA sequence Show only first row Show all	>Potri.003G026150.1 pacid=42785087 polypeptide=Potri.003G026150.1.p locus=Potri.003G026150 ID=Potri.003G026150.1.v4.1 annot-version=v4.1 MATNPTKGTLLVLVDPKLGQDYNKEEVIIMINVALLCSNVSAAVRPAMSSVVSMLEGKAVVQDIDIPDKSMSTDEKKIEEMRRHFQVINEQEISETRTLS MDGPSTAASTSAGDLYPVSLDSDYWKGRE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G14840			Leucine-rich repeat transmembr...		Potri.003G026150 [exp]	0	1
AT3G14840			Leucine-rich repeat transmembr...		Potri.001G385200 [exp]	2.00	0.8858
AT3G03620			MATE efflux family protein (.1...		Potri.013G069400 [exp]	8.48	0.8103
AT1G75220		AtERDL6	ERD6-like 6, Major facilitator...		Potri.002G259900 [exp]	8.66	0.8107
AT2G21120			Protein of unknown function (D...		Potri.019G001100 [exp]	11.31	0.7770
AT3G45240		ATSNAK2, GRIK1	geminivirus rep interacting ki...		Potri.001G010700 [exp]	13.85	0.7927
					Potri.005G212601 [exp]	16.70	0.7251
AT3G49050			alpha/beta-Hydrolases superfam...		Potri.012G142700 [exp]	20.39	0.7526
AT5G23170			Protein kinase superfamily pro...		Potri.004G221800 [exp]	22.44	0.7840
AT3G53570		AME2, AFC1	FUS3-complementing gene 1 (.1....		Potri.006G213400 [exp]	27.11	0.7509	Pt-AFC1.2
AT1G27320		AHK3	histidine kinase 3 (.1)		Potri.001G057400 [exp]	27.22	0.7718	PHK3,AHK3.1

Compare expression of checked genes

Potri.003G026150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.