Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26590 61 / 8e-13 RPN13 regulatory particle non-ATPase 13 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G078800 [exp] 76 / 3e-18 AT2G26590 386 / 2e-135 regulatory particle non-ATPase 13 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040571 [exp] 63 / 2e-13 AT2G26590 343 / 1e-118 regulatory particle non-ATPase 13 (.1.2.3) Lus10021598 [exp] 62 / 5e-13 AT2G26590 306 / 2e-103 regulatory particle non-ATPase 13 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G027520.1 pacid=42787261 polypeptide=Potri.003G027520.1.p locus=Potri.003G027520 ID=Potri.003G027520.1.v4.1 annot-version=v4.1 ATGCTTGAAGATAATATCTCATCAAGGACTGGAAACTTAGTTGTCCCAGACCTTGGTGCAGAAGTAATGAATGATGTAAACTCTTCATCAGAACCAGTGA GATTGGAAGACTTGCAAAGAATCCTGAGTAATATTGGTTCTGGAGGTGTGTTCTGCTCAGATAGTGCAAGTGACCATATCCTTGTTTGTTGTACTTAG
AA sequence Show only first row Show all	>Potri.003G027520.1 pacid=42787261 polypeptide=Potri.003G027520.1.p locus=Potri.003G027520 ID=Potri.003G027520.1.v4.1 annot-version=v4.1 MLEDNISSRTGNLVVPDLGAEVMNDVNSSSEPVRLEDLQRILSNIGSGGVFCSDSASDHILVCCT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G26590		RPN13	regulatory particle non-ATPase...		Potri.003G027520 [exp]	0	1
AT3G14470			NB-ARC domain-containing disea...		Potri.003G200500 [exp]	13.56	0.8353
AT1G43770			RING/FYVE/PHD zinc finger supe...		Potri.007G110400 [exp]	20.09	0.8346
AT1G53440			Leucine-rich repeat transmembr...		Potri.011G072766 [exp]	22.58	0.7950
					Potri.012G060751 [exp]	24.97	0.8118
AT4G14370			Disease resistance protein (TI...		Potri.011G014501 [exp]	30.29	0.8048
AT5G02500		AtHsp70-1, AT-H...	HEAT SHOCK PROTEIN 70-1, ARABI...		Potri.010G205550 [exp]	31.63	0.8116
					Potri.004G111750 [exp]	32.40	0.8032
AT3G07330		ATCSLC6, ATCSLC...	CELLULOSE-SYNTHASE LIKE C6, Ce...		Potri.014G190701 [exp]	32.40	0.8323
AT3G61540			alpha/beta-Hydrolases superfam...		Potri.002G164700 [exp]	39.79	0.8029
AT3G18360			VQ motif-containing protein (....		Potri.012G055900 [exp]	41.58	0.8045

Compare expression of checked genes

Potri.003G027520 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.