Potri.003G030500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49390 321 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G20400 310 / 2e-104 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G54000 302 / 4e-101 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G20550 301 / 1e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17020 210 / 3e-65 ATSRG1, SRG1 senescence-related gene 1 (.1)
AT2G38240 207 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G17010 206 / 1e-63 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G25300 202 / 5e-62 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT4G10500 198 / 1e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G78550 197 / 4e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G030451 686 / 0 AT1G49390 321 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.003G030400 634 / 0 AT1G49390 320 / 2e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G121700 359 / 2e-123 AT5G20400 426 / 8e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G062500 355 / 8e-122 AT5G20400 432 / 2e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G121800 349 / 1e-119 AT5G54000 407 / 2e-142 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G023600 209 / 1e-64 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G101100 200 / 2e-61 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G355100 200 / 2e-61 AT1G17020 439 / 1e-154 senescence-related gene 1 (.1)
Potri.001G381700 199 / 9e-61 AT1G17020 436 / 2e-153 senescence-related gene 1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008824 316 / 1e-106 AT1G49390 410 / 2e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10039975 283 / 7e-94 AT1G49390 309 / 5e-104 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10008826 269 / 3e-88 AT1G49390 298 / 1e-99 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10006518 214 / 2e-66 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10030995 206 / 3e-63 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1)
Lus10026173 206 / 4e-63 AT1G17020 443 / 5e-156 senescence-related gene 1 (.1)
Lus10028068 201 / 6e-62 AT5G08640 429 / 1e-151 flavonol synthase 1 (.1.2)
Lus10011980 200 / 2e-61 AT1G17020 382 / 1e-132 senescence-related gene 1 (.1)
Lus10030934 200 / 3e-61 AT1G17020 337 / 2e-114 senescence-related gene 1 (.1)
Lus10022292 199 / 8e-61 AT1G17020 449 / 5e-159 senescence-related gene 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
CL0029 Cupin PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence
>Potri.003G030500.1 pacid=42785900 polypeptide=Potri.003G030500.1.p locus=Potri.003G030500 ID=Potri.003G030500.1.v4.1 annot-version=v4.1
ATGGCTGGAGTTTCAGCTCTCCCTGCAAAGATTTTACTATCAAAGCGTGTTCAGGAAATGGTCCTCAACGATGAAGAACTACAAAAGCCATACATCAGTA
GAAATGATGGCACTAATGAAGCAATTCCCCGTCCCCCATCTGATCTGATTCCGATCATAGACCTCAGCCTCCTCTCTTCTTCAGAGCCATGCTCTGCACA
AGAACTGCAGCGGCTTAGATCAGCTCTTTGTTCATGGGGCTGCTTTCAGGCAACAGGTCACGGTATTCCAAAATCATTTCTTGATAAGATTCGCCAAGTA
GCAAGGGATTTCTTCGAGCAGCCAATGGAGGAGAAGAAAAGGCATGCTAAAGGAGTGGAAGAGTTTGAAGGATATGGAGCTGATCCTGTCCCAGCAGAAG
GACAGTCGCTTGACTGGTCTGATCGCTTATTTCTTAACGTATACCCAGAAGATCGAAGGAAGCATAAGTTTTGGCCGGAGAATCCAAAATCATTCAGAGA
GGTTTTAGAAGAATACACTTCTCGGATGCAAATATTCACAGAGCTTGTCTCAAAAGCTATGGCAAAGTCATTGAACTTGGAAGCAGATTGCTTCCTGAAT
CAGTTTGGCAAACAAGCAACACTAAAAGCAAGGTTCAACTACTACTCACCGTGTCAGAGGCCTGATCTTGTTCTAGGTTTGAGAGCCCATGCAGATGGAT
CAGGGTACACCATTATCTTGCAAGACGATGTAGAAGGTCTTCAGGTCTTCAAAGATGAGCGATGGTTCACAGTTCCTGCAATTTCTGATGCTCTCCTAGT
ACTCATGGGTGATCAAATGGAGATAATGACCAATGGGGTGTTCAAGAGCCCAGTTCATAGAGTTTTGACCACCTCAGAGAAGGAGAGGATTTCTGTGGCT
GTCTTCTACGCACCTGAACCAAATAAAGAGATTGGACCAGAAGAAGGTTTGATCAATGAGGAAAGAAAACAAATATACAAGAAAGTGAAAGAGTATTCTG
TTGTGCACTGGGAACACTACCAGCAAGGAAAGAGGGCAATTCATGTGGCAAAAGTTTAG
AA sequence
>Potri.003G030500.1 pacid=42785900 polypeptide=Potri.003G030500.1.p locus=Potri.003G030500 ID=Potri.003G030500.1.v4.1 annot-version=v4.1
MAGVSALPAKILLSKRVQEMVLNDEELQKPYISRNDGTNEAIPRPPSDLIPIIDLSLLSSSEPCSAQELQRLRSALCSWGCFQATGHGIPKSFLDKIRQV
ARDFFEQPMEEKKRHAKGVEEFEGYGADPVPAEGQSLDWSDRLFLNVYPEDRRKHKFWPENPKSFREVLEEYTSRMQIFTELVSKAMAKSLNLEADCFLN
QFGKQATLKARFNYYSPCQRPDLVLGLRAHADGSGYTIILQDDVEGLQVFKDERWFTVPAISDALLVLMGDQMEIMTNGVFKSPVHRVLTTSEKERISVA
VFYAPEPNKEIGPEEGLINEERKQIYKKVKEYSVVHWEHYQQGKRAIHVAKV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G49390 2-oxoglutarate (2OG) and Fe(II... Potri.003G030500 0 1
AT1G49390 2-oxoglutarate (2OG) and Fe(II... Potri.003G030451 1.00 0.9268
AT1G22340 ATUGT85A7 UDP-glucosyl transferase 85A7 ... Potri.007G132400 31.78 0.7514
AT3G63520 ATNCED1, ATCCD1... carotenoid cleavage dioxygenas... Potri.001G265400 156.81 0.7506
AT1G27680 APL2 ADPGLC-PPase large subunit (.1... Potri.005G229700 209.36 0.7316

Potri.003G030500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.