Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55190 160 / 3e-50 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) AT3G13710 145 / 3e-44 PRA1.F4 prenylated RAB acceptor 1.F4 (.1) AT3G13720 140 / 4e-42 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1) AT1G17700 114 / 4e-32 PRA1.F1 prenylated RAB acceptor 1.F1 (.1) AT2G38360 96 / 1e-24 PRA1.B4 prenylated RAB acceptor 1.B4 (.1) AT1G04260 95 / 1e-24 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1) AT3G56110 93 / 2e-23 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2) AT1G08770 92 / 4e-23 PRA1.E prenylated RAB acceptor 1.E (.1) AT5G05380 92 / 7e-23 PRA1.B3 prenylated RAB acceptor 1.B3 (.1) AT5G01640 83 / 2e-19 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G054700 [exp] 132 / 1e-38 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1) Potri.002G044000 [exp] 127 / 4e-37 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G219100 [exp] 118 / 2e-33 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.002G043800 [exp] 112 / 5e-31 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.010G183300 [exp] 87 / 3e-21 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.016G126400 [exp] 86 / 1e-20 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1) Potri.006G104400 [exp] 85 / 2e-20 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1) Potri.019G124100 [exp] 84 / 3e-20 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.008G074000 [exp] 81 / 7e-19 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005088 [exp] 161 / 3e-50 AT1G55190 199 / 3e-65 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10034363 [exp] 157 / 1e-48 AT1G55190 197 / 1e-64 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10015631 [exp] 154 / 2e-47 AT1G55190 193 / 7e-63 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10037649 [exp] 127 / 4e-37 AT1G55190 153 / 2e-47 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10033859 [exp] 110 / 2e-30 AT1G55190 149 / 1e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10014747 [exp] 109 / 8e-30 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10021996 [exp] 106 / 2e-28 AT1G08770 162 / 3e-50 prenylated RAB acceptor 1.E (.1) Lus10026404 [exp] 99 / 7e-26 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10042535 [exp] 99 / 1e-25 AT1G08770 157 / 1e-48 prenylated RAB acceptor 1.E (.1) Lus10042246 [exp] 98 / 6e-25 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03208 [poplar] [flax] PRA1 PRA1 family protein
Representative CDS sequence Show only first row Show all	>Potri.003G035200.2 pacid=42787529 polypeptide=Potri.003G035200.2.p locus=Potri.003G035200 ID=Potri.003G035200.2.v4.1 annot-version=v4.1 ATGGCAAACTACGGCACAATCCCGACCTCTTCCTCACCGGGAAGCTCCACGAAACTTGAATACATTTCTCGTGCCAAAGAGCGCATAAAAGCTGGTCTGG GCACACGTCAGCCATGGAAAGTGATGTTCAACTTCCGGTCTTTCAACTTCCCTGGCACTCTATCAGATGCGCTAGCAAGAGTTAGAAAAAACATCGCCTA CTTTACTATGAACTACGCGATAGTAGTGCTGATAATCTTGTTCTTGAGCTTGTTATGGCACCCTGTCTCTCTCATAGTATTTATTGTCATGGGAGTTGCG TGGGTGTGCTTGTACTTCTTGCGTGATGAGCCCCTTGTGGTTTTAGGCCGCACAATTGATGATCGTGTGGTGATGATCGTGTTGGGGGTGTTGACCATCT TCTTCTTGTTGTTGACACATGTGACCTGGAATGTTCTGGTTTCACTCTTGGTTGGCGTGGTTCTGGTTTTGATTCATGGGGTTACAAGGAAGATTGATGA TTTGTCCTTGGATGAAGAAACTACTGGGCTGATGAGTTCTACTCATGCTGCCGGTGCCGGTGACGGTGCCGGACCTTCTTCTTAA
AA sequence Show only first row Show all	>Potri.003G035200.2 pacid=42787529 polypeptide=Potri.003G035200.2.p locus=Potri.003G035200 ID=Potri.003G035200.2.v4.1 annot-version=v4.1 MANYGTIPTSSSPGSSTKLEYISRAKERIKAGLGTRQPWKVMFNFRSFNFPGTLSDALARVRKNIAYFTMNYAIVVLIILFLSLLWHPVSLIVFIVMGVA WVCLYFLRDEPLVVLGRTIDDRVVMIVLGVLTIFFLLLTHVTWNVLVSLLVGVVLVLIHGVTRKIDDLSLDEETTGLMSSTHAAGAGDGAGPSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Potri.003G035200 [exp]	0	1
AT5G03150	C2H2ZnF	JKD	JACKDAW, C2H2-like zinc finger...		Potri.006G129300 [exp]	3.60	0.8530
AT5G18170		GDH1	glutamate dehydrogenase 1 (.1)		Potri.013G058300 [exp]	5.29	0.8438	Pt-GDH1.2
AT1G78580		ATTPS1	TREHALOSE-6-PHOSPHATE SYNTHASE...		Potri.001G383600 [exp]	6.63	0.8030
AT1G66200		ATGSR2, GLN1;2	glutamine synthetase 1;2, glut...		Potri.017G131100 [exp]	7.74	0.8171	Pt-CYTGS.5
AT1G28200		FIP1	FH interacting protein 1 (.1)		Potri.002G184100 [exp]	10.24	0.8160
AT2G39840		TOPP4	type one serine/threonine prot...		Potri.008G166300 [exp]	10.39	0.8268
AT2G23430		ICK1, KRP1	KIP-RELATED PROTEIN 1, Cyclin-...		Potri.007G042300 [exp]	15.58	0.7817
AT3G04030	GARP		Homeodomain-like superfamily p...		Potri.013G060200 [exp]	16.24	0.8132	Pt-MYR1.2
AT4G10170			SNARE-like superfamily protein...		Potri.003G048600 [exp]	16.27	0.7600
AT3G57560		NAGK	N-acetyl-l-glutamate kinase (....		Potri.018G001600 [exp]	16.49	0.7743

Compare expression of checked genes

Potri.003G035200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.