Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17650 158 / 6e-49 GR2, GLYR2 glyoxylate reductase 2 (.1) AT3G25530 112 / 4e-32 GR1, GLYR1, GHBDH, ATGHBDH glyoxylate reductase 1 (.1.2) AT4G29120 41 / 2e-05 6-phosphogluconate dehydrogenase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G038450 [exp] 169 / 2e-55 AT1G17650 217 / 8e-71 glyoxylate reductase 2 (.1) Potri.003G040800 [exp] 168 / 6e-53 AT1G17650 508 / 0.0 glyoxylate reductase 2 (.1) Potri.014G197900 [exp] 111 / 2e-31 AT3G25530 463 / 1e-166 glyoxylate reductase 1 (.1.2) Potri.001G211500 [exp] 39 / 0.0001 AT1G71180 310 / 2e-105 6-phosphogluconate dehydrogenase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015612 [exp] 156 / 3e-46 AT1G17650 495 / 4e-172 glyoxylate reductase 2 (.1) Lus10037629 [exp] 150 / 7e-46 AT1G17650 486 / 9e-174 glyoxylate reductase 2 (.1) Lus10012301 [exp] 115 / 4e-33 AT3G25530 434 / 3e-155 glyoxylate reductase 1 (.1.2) Lus10016077 [exp] 112 / 2e-30 AT3G57220 611 / 0.0 Glycosyl transferase family 4 protein (.1) Lus10001349 [exp] 43 / 7e-06 AT1G71180 335 / 4e-115 6-phosphogluconate dehydrogenase family protein (.1) Lus10015455 [exp] 40 / 0.0001 AT1G71180 243 / 2e-78 6-phosphogluconate dehydrogenase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0106 [poplar] [flax] 6PGD_C PF14833 [poplar] [flax] NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Representative CDS sequence Show only first row Show all	>Potri.003G036600.3 pacid=42786865 polypeptide=Potri.003G036600.3.p locus=Potri.003G036600 ID=Potri.003G036600.3.v4.1 annot-version=v4.1 ATGAAACTTATTGTCAACATGATCATGGGCAGTATGATGGCAACCTTTTCTGAAGGGTTGCTTCTCAGCGAGAAAGTAGGACTGGACCCAAATGTACTGG TTGAGGTAGTGTCACTGGGTGCCATTAGTGCACCGATGTATTCGCTGAAAGGTCCATCAATGGTCAAATCTCTATACCCTACTGCTTTTCCCTTAAAGCA TCAGCAGAAGGACATGAGACTTGCCCTGGGATTAGCAGAATCTGTTTCCCAACCCACTCATTGCAGCAGCTGCAAATGA
AA sequence Show only first row Show all	>Potri.003G036600.3 pacid=42786865 polypeptide=Potri.003G036600.3.p locus=Potri.003G036600 ID=Potri.003G036600.3.v4.1 annot-version=v4.1 MKLIVNMIMGSMMATFSEGLLLSEKVGLDPNVLVEVVSLGAISAPMYSLKGPSMVKSLYPTAFPLKHQQKDMRLALGLAESVSQPTHCSSCK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17650		GR2, GLYR2	glyoxylate reductase 2 (.1)		Potri.003G036600 [exp]	0	1
AT5G24930	CO	COL4, ATCOL4	CONSTANS-like 4 (.1)		Potri.006G267700 [exp]	1.73	0.9115	Pt-COL1.1
AT5G59250			Major facilitator superfamily ...		Potri.001G244100 [exp]	2.64	0.8985
AT2G35840			Sucrose-6F-phosphate phosphohy...		Potri.006G199800 [exp]	2.82	0.8909	Pt-SPP1.1
AT4G14210		PDE226, PDS3	PIGMENT DEFECTIVE 226, phytoen...		Potri.004G177400 [exp]	5.00	0.9098
AT5G15140			Galactose mutarotase-like supe...		Potri.017G080000 [exp]	6.32	0.9098
AT2G44920			Tetratricopeptide repeat (TPR)...		Potri.010G200000 [exp]	6.92	0.9143
AT5G43630		TZP	zinc knuckle (CCHC-type) famil...		Potri.008G162150 [exp]	10.48	0.8850
AT4G00730	HD	AHDP, ANL2	ANTHOCYANINLESS 2, ARABIDOPSIS...		Potri.002G154700 [exp]	10.67	0.9051	Pt-ANL2.1
AT1G05230	HD	HDG2	homeodomain GLABROUS 2 (.1.2.3...		Potri.014G152000 [exp]	12.36	0.8873
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Potri.017G048200 [exp]	13.41	0.8738

Compare expression of checked genes

Potri.003G036600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.