Potri.003G037100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G196150 37 / 8e-05 AT3G13845 / unknown protein
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G037100.1 pacid=42784850 polypeptide=Potri.003G037100.1.p locus=Potri.003G037100 ID=Potri.003G037100.1.v4.1 annot-version=v4.1
ATGGCAGTAAAACCAACAGTTGCCTTGAGGGCTGTACTTGTAGGGGGTGTAGCAATATTTGCGAAAGTAGCAAGTGTAATGAAGGCTGCTGGTGGTGTGA
AGCTAGGGGCTGCTGCAGCAGCTGTCACAGCAGCTGCAACTGCTGCTATTTCTGGACCAAAAAAAGATTCAAATGATACCTCACCTTCACCTTCACCTTC
ACAGTGA
AA sequence
>Potri.003G037100.1 pacid=42784850 polypeptide=Potri.003G037100.1.p locus=Potri.003G037100 ID=Potri.003G037100.1.v4.1 annot-version=v4.1
MAVKPTVALRAVLVGGVAIFAKVASVMKAAGGVKLGAAAAAVTAAATAAISGPKKDSNDTSPSPSPSQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G13845 unknown protein Potri.003G037100 0 1
AT1G67785 unknown protein Potri.015G087301 5.29 0.8696
AT2G23940 Protein of unknown function (D... Potri.018G101100 13.78 0.8580
AT2G47320 Cyclophilin-like peptidyl-prol... Potri.002G194250 14.49 0.8672
AT3G55440 CYTOTPI, ATCTIM... CYTOSOLIC ISOFORM TRIOSE PHOSP... Potri.010G203500 17.54 0.8473 Pt-CTIMC.2
AT2G22425 Microsomal signal peptidase 12... Potri.008G175775 20.42 0.8661
AT1G01170 Protein of unknown function (D... Potri.006G051900 26.07 0.8286 ATOZI1.1
AT5G48580 FKBP15-2 FK506- and rapamycin-binding p... Potri.002G248200 26.75 0.8583
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Potri.008G155500 27.33 0.8530 Pt-PBD2.3
AT1G31812 ACBP6, ACBP acyl-CoA-binding protein 6 (.1... Potri.001G130200 33.01 0.7806
AT5G11900 Translation initiation factor ... Potri.018G052900 34.59 0.8442

Potri.003G037100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.