Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17620 208 / 1e-66 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G11890 135 / 3e-38 EMB3135 EMBRYO DEFECTIVE 3135, unknown protein AT5G36970 69 / 1e-13 NHL25 NDR1/HIN1-like 25 (.1) AT1G54540 59 / 4e-10 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G01110 59 / 5e-10 unknown protein AT5G21130 59 / 7e-10 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G01410 56 / 4e-09 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G65690 56 / 7e-09 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11650 52 / 8e-08 NHL2 NDR1/HIN1-like 2 (.1) AT5G22200 47 / 2e-06 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G200700 [exp] 382 / 1e-135 AT1G17620 168 / 2e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.018G052500 [exp] 182 / 1e-56 AT5G11890 198 / 3e-62 EMBRYO DEFECTIVE 3135, unknown protein Potri.006G228600 [exp] 179 / 2e-55 AT5G11890 171 / 4e-52 EMBRYO DEFECTIVE 3135, unknown protein Potri.015G148200 [exp] 73 / 7e-15 AT5G36970 227 / 2e-74 NDR1/HIN1-like 25 (.1) Potri.009G158900 [exp] 73 / 8e-15 AT2G27080 259 / 8e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.002G180000 [exp] 70 / 3e-14 AT4G01410 232 / 9e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G145500 [exp] 71 / 4e-14 AT5G36970 238 / 2e-78 NDR1/HIN1-like 25 (.1) Potri.017G154000 [exp] 67 / 4e-13 AT1G54540 242 / 1e-80 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G197600 [exp] 66 / 2e-12 AT2G27080 264 / 8e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015622 [exp] 241 / 2e-79 AT1G17620 196 / 5e-62 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10037638 [exp] 238 / 2e-78 AT1G17620 201 / 4e-64 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10003824 [exp] 215 / 2e-69 AT1G17620 191 / 5e-60 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10026428 [exp] 179 / 2e-55 AT5G11890 209 / 7e-67 EMBRYO DEFECTIVE 3135, unknown protein Lus10024987 [exp] 81 / 1e-18 AT5G11890 87 / 5e-21 EMBRYO DEFECTIVE 3135, unknown protein Lus10007364 [exp] 72 / 1e-14 AT1G65690 267 / 6e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020783 [exp] 64 / 7e-12 AT5G36970 229 / 2e-75 NDR1/HIN1-like 25 (.1) Lus10010103 [exp] 61 / 9e-11 AT4G01410 198 / 7e-64 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10031888 [exp] 58 / 8e-10 AT1G54540 236 / 2e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10010130 [exp] 53 / 4e-08 AT2G46300 139 / 2e-40 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.003G039400.2 pacid=42785962 polypeptide=Potri.003G039400.2.p locus=Potri.003G039400 ID=Potri.003G039400.2.v4.1 annot-version=v4.1 ATGACAGACAGGGTCTACCCTTCTACTAAACCAGCCACAAATGGCACAGCAGCTACCAACCCCTCCTTTCCAGCCACAAATGGCACAGCAGCCACCAACC CCTCCTTTCCAGCCACCAAAGCCCAACTCTATGGTGCCACCCGCCCCACCTACCGCCCCCAACCCAACCGCAAACGCAGCCGCAGTTGCTGCTGTGCCTG TGTTTTATGGACTACAGCGGTCATCTTCATTCTCATAGTCCTTGCTGTCATAGCTGGAGCCATCATCTACGTCCTCTACCGACCCCACCGCCCCTCCTTC GACGTCTCCGGCCTCAGTATCTCCTCTCTCAACCTTACCTCAGCTTCCCATCTCACCACCAACATCAACCTCAACATCACCGCTAGAAACCCTAATAAAA AACTTGTCTACACATATAACCCCATCACCATATCTGTGACTACAGAAAGAGATGATATCGTTGTAGGCAGTGGTTCGCTACCCTCATTTGTGCATGGTAC CAAGAACACAACCTTTTTGAGAGCCGCCATCACAAGCAGTGGCGTGCAACTGGATGATGTATCTGCTGGTAAGTTAAAGGCTGATTTGAAGAGCAAGAAT GGTGTGGCTTTGAAGTTAGAGCTGGAGACTAAAGTGAAGGTCAAGATGGGAGGGTTAAAGACTCCAAAGGCTAGGATTAGGGTCACTTGTCAAGGGATTA AAGCCACTGTTCCATCTGGGAAAAAAGCAACAACAGCATCTGTGTCAAATGCAAAGTGCAAGGTTGATTTGAGGATCAAGATCTGGAAGTGGACTTTCTA A
AA sequence Show only first row Show all	>Potri.003G039400.2 pacid=42785962 polypeptide=Potri.003G039400.2.p locus=Potri.003G039400 ID=Potri.003G039400.2.v4.1 annot-version=v4.1 MTDRVYPSTKPATNGTAATNPSFPATNGTAATNPSFPATKAQLYGATRPTYRPQPNRKRSRSCCCACVLWTTAVIFILIVLAVIAGAIIYVLYRPHRPSF DVSGLSISSLNLTSASHLTTNINLNITARNPNKKLVYTYNPITISVTTERDDIVVGSGSLPSFVHGTKNTTFLRAAITSSGVQLDDVSAGKLKADLKSKN GVALKLELETKVKVKMGGLKTPKARIRVTCQGIKATVPSGKKATTASVSNAKCKVDLRIKIWKWTF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17620			Late embryogenesis abundant (L...		Potri.003G039400 [exp]	0	1
AT1G28520	VOZ	ATVOZ1, VOZ1	vascular plant one zinc finger...		Potri.013G123100 [exp]	2.00	0.8893
AT4G26450		WIP1	unknown protein		Potri.001G472600 [exp]	3.16	0.8505
AT1G43700	bZIP	SUE3, AtbZIP51,...	sulphate utilization efficienc...		Potri.002G069500 [exp]	5.74	0.8713
AT5G01990			Auxin efflux carrier family pr...		Potri.016G141700 [exp]	6.92	0.8253
AT2G15560			Putative endonuclease or glyco...		Potri.004G140400 [exp]	7.00	0.8379
AT1G33520		MOS2	modifier of snc1, 2, D111/G-pa...		Potri.001G129700 [exp]	10.09	0.8479
AT5G39710		EMB2745	EMBRYO DEFECTIVE 2745, Tetratr...		Potri.009G105600 [exp]	10.58	0.8561
AT4G00660		ATRH8	RNAhelicase-like 8 (.1.2)		Potri.014G081100 [exp]	11.83	0.8179
AT4G14350			AGC (cAMP-dependent, cGMP-depe...		Potri.011G157000 [exp]	13.56	0.8368
AT3G10960		ATAZG1	AZA-guanine resistant1 (.1)		Potri.013G083300 [exp]	15.09	0.8183

Compare expression of checked genes

Potri.003G039400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.