Potri.003G041100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G13882 154 / 6e-49 Ribosomal protein L34 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037626 150 / 1e-47 AT3G13882 157 / 2e-50 Ribosomal protein L34 (.1.2)
Lus10015609 131 / 9e-40 AT3G13882 134 / 2e-40 Ribosomal protein L34 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00468 Ribosomal_L34 Ribosomal protein L34
Representative CDS sequence
>Potri.003G041100.1 pacid=42784832 polypeptide=Potri.003G041100.1.p locus=Potri.003G041100 ID=Potri.003G041100.1.v4.1 annot-version=v4.1
ATGGCGACCAAAAACTTAATTCGAGCAGGAGCATCCCTAATGAACAGATTGATTATATCGAAGAACCCAATTTTACATCCAAACGCAGTCTCCACTCACC
AAACACTAACTCCTCACCTTTTCCCTTCTTCTGTCTCCAACTTCCAGCCAACCGACTTCCTCTCAATCACTAAACTTGCAGTTGCCAATCAAGACTTCTT
GCATCCTTCCGGTCTCCCCTCTCTCGAATTCTTCTTGCCCGACGGAGATTCATCTACTGAGCCTATGCTCTTGTTTCCTAAGAGGACATACCAGCCTAGT
GTCATCAGGCGCAAGAGAAAACACGGGTTCTTTGCACGCAAGGCAACCAAGGGTGGTCGGAGAGTAATTGCTCGGAGAATAGCAAAAGGCCGGTCAAGAG
TTACTGCTTAG
AA sequence
>Potri.003G041100.1 pacid=42784832 polypeptide=Potri.003G041100.1.p locus=Potri.003G041100 ID=Potri.003G041100.1.v4.1 annot-version=v4.1
MATKNLIRAGASLMNRLIISKNPILHPNAVSTHQTLTPHLFPSSVSNFQPTDFLSITKLAVANQDFLHPSGLPSLEFFLPDGDSSTEPMLLFPKRTYQPS
VIRRKRKHGFFARKATKGGRRVIARRIAKGRSRVTA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G13882 Ribosomal protein L34 (.1.2) Potri.003G041100 0 1
AT2G34480 Ribosomal protein L18ae/LX fam... Potri.011G072400 1.00 0.8746 RPL18.5
AT5G15750 Alpha-L RNA-binding motif/Ribo... Potri.004G113600 2.44 0.8199
AT1G07210 Ribosomal protein S18 (.1) Potri.006G170500 4.24 0.7903
AT3G06610 DNA-binding enhancer protein-r... Potri.008G105000 4.89 0.8288
AT1G30880 unknown protein Potri.003G155400 5.47 0.7971
AT5G15750 Alpha-L RNA-binding motif/Ribo... Potri.017G101200 5.91 0.7892
AT5G04600 RNA-binding (RRM/RBD/RNP motif... Potri.010G234800 10.09 0.7219
AT2G37990 ribosome biogenesis regulatory... Potri.005G231000 11.22 0.7863
AT1G80750 Ribosomal protein L30/L7 famil... Potri.003G180700 11.48 0.8088
AT3G13230 RNA-binding KH domain-containi... Potri.001G469200 15.00 0.7771

Potri.003G041100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.