Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34400 226 / 6e-70 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT2G33760 154 / 3e-43 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G36730 144 / 4e-40 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G59720 142 / 1e-38 CRR28 CHLORORESPIRATORY REDUCTION28, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G16860 136 / 2e-36 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G48910 132 / 3e-35 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G05240 131 / 4e-35 MEF19 mitochondrial editing factor 19 (.1) AT4G25270 130 / 9e-35 OTP70 organelle transcript processing 70, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G08820 130 / 2e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G21065 129 / 4e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G108000 [exp] 411 / 1e-141 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.003G041501 [exp] 392 / 2e-139 AT2G34400 251 / 1e-79 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G145514 [exp] 282 / 3e-93 AT2G34400 472 / 4e-162 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G145510 [exp] 256 / 5e-83 AT2G34400 462 / 3e-158 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G147873 [exp] 224 / 5e-75 AT2G34400 168 / 5e-50 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.001G064301 [exp] 223 / 1e-74 AT2G34400 170 / 7e-51 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.018G144401 [exp] 219 / 2e-73 AT2G34400 164 / 9e-49 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.011G052300 [exp] 164 / 6e-47 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G043400 [exp] 157 / 3e-44 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010320 [exp] 257 / 5e-82 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10018492 [exp] 159 / 6e-45 AT4G18750 385 / 2e-123 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10039703 [exp] 149 / 2e-41 AT4G18750 394 / 6e-127 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10025490 [exp] 146 / 3e-40 AT2G33760 734 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10040171 [exp] 140 / 1e-39 AT2G36730 456 / 4e-159 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10004052 [exp] 144 / 2e-39 AT1G31430 684 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10002024 [exp] 140 / 9e-39 AT5G56310 344 / 6e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10002552 [exp] 135 / 1e-38 AT2G22410 299 / 2e-97 SLOW GROWTH 1 (.1) Lus10002288 [exp] 139 / 2e-37 AT1G31430 689 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10031661 [exp] 136 / 1e-36 AT2G29760 427 / 3e-141 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.003G041650.1 pacid=42785562 polypeptide=Potri.003G041650.1.p locus=Potri.003G041650 ID=Potri.003G041650.1.v4.1 annot-version=v4.1 ATGCTTATAAACTCAATACCAGAACCCAATTTCCTTTCCAAAATCATTGACCTCAAAGACTTGGCCTATGCATCCCTTGTTTTTAATCAAATCACCAAAC AATTCCTTCAATGTCATGCTTCGTGGGTTAGCTACCACATAGCTACCACATGGAAACAGTATGATTTTTGTGCTGAATTATATTACAAGCTGAAGTCTTT AGGCCTAAAAGCAAATAATTTTACATACCCTTTTTTGTTTATAGCGTGTGGGAATGTTTGGGGTTTGCTTCATGGAAAGATCGATCATCGTCTGGTGTTT AAGGCTGGTTTGGATGGTGATGAGTACGTGAATCGTTCTTTGATTACAATGTACAAAAGGTGTGGTGAAATGGGGTTTGCACGGATGGTGTTTGATGAAA TGGATGAGAGAGAGTTGGTGTCATGGAATTCGATGATCTCGGGGTATTCTAAGACGAGTTTTGCTAAAGAGGCATTTGGGTTGTTTATGGAAATGAGGGA GAAGGGGTTTGAGCTAGATGAGATGACGTTGGTGAGTGTTCTTGGGGCGTGTGGGGATTTGGGTTTGGGGAGATGGGTGGAGGGGTTTGTTTTGGAGAAG AAGGTGGAGGTAAATTCATATGTGGGGTCTGCTTTGATTGACATGTATGGTATGTGTAGGGATTTGATATTTGCGAGGAGGGTCTTTGATTCAATGCCAA ACAAGGATGTTGTCACTTGGAATGCCATTATCACAGGGTAA
AA sequence Show only first row Show all	>Potri.003G041650.1 pacid=42785562 polypeptide=Potri.003G041650.1.p locus=Potri.003G041650 ID=Potri.003G041650.1.v4.1 annot-version=v4.1 MLINSIPEPNFLSKIIDLKDLAYASLVFNQITKQFLQCHASWVSYHIATTWKQYDFCAELYYKLKSLGLKANNFTYPFLFIACGNVWGLLHGKIDHRLVF KAGLDGDEYVNRSLITMYKRCGEMGFARMVFDEMDERELVSWNSMISGYSKTSFAKEAFGLFMEMREKGFELDEMTLVSVLGACGDLGLGRWVEGFVLEK KVEVNSYVGSALIDMYGMCRDLIFARRVFDSMPNKDVVTWNAIITG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.003G041650 [exp]	0	1
AT3G26750			unknown protein		Potri.007G019800 [exp]	1.41	0.7260
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.003G041501 [exp]	1.73	0.6816
AT3G11460			Pentatricopeptide repeat (PPR)...		Potri.006G211400 [exp]	5.47	0.6901
AT2G34400			Pentatricopeptide repeat (PPR-...		Potri.018G144960 [exp]	6.32	0.5890
AT1G15000		SCPL50	serine carboxypeptidase-like 5...		Potri.005G060100 [exp]	11.61	0.6302
AT1G03530		ATNAF1	nuclear assembly factor 1 (.1)		Potri.019G104400 [exp]	13.49	0.5852
AT1G27650	C3HZnF	ATU2AF35A	U2 snRNP auxiliary factor smal...		Potri.005G258000 [exp]	17.74	0.6034
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.001G262900 [exp]	20.19	0.5856
AT4G00330		CRCK2	calmodulin-binding receptor-li...		Potri.001G434200 [exp]	22.24	0.5928
AT3G15880		WSIP2, TPR4	TOPLESS-RELATED 4, WUS-interac...		Potri.018G128000 [exp]	24.65	0.6425

Compare expression of checked genes

Potri.003G041650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.