Potri.003G043200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G60970 288 / 4e-101 SNARE-like superfamily protein (.1)
AT4G08520 286 / 3e-100 SNARE-like superfamily protein (.1)
AT3G09800 286 / 5e-100 SNARE-like superfamily protein (.1)
AT2G19790 39 / 0.0004 SNARE-like superfamily protein (.1)
AT1G15370 39 / 0.0005 SNARE-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G197200 351 / 6e-126 AT3G09800 287 / 1e-100 SNARE-like superfamily protein (.1)
Potri.001G352900 258 / 3e-89 AT1G60970 278 / 6e-97 SNARE-like superfamily protein (.1)
Potri.006G149100 40 / 0.0002 AT2G19790 287 / 1e-101 SNARE-like superfamily protein (.1)
Potri.005G122900 40 / 0.0002 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1)
Potri.007G025400 39 / 0.0007 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1)
Potri.001G193100 39 / 0.0007 AT1G15370 263 / 7e-92 SNARE-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037624 323 / 2e-114 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Lus10006883 323 / 2e-114 AT4G08520 287 / 3e-100 SNARE-like superfamily protein (.1)
Lus10025383 245 / 1e-83 AT1G60970 235 / 6e-80 SNARE-like superfamily protein (.1)
Lus10015263 57 / 2e-11 AT1G60970 55 / 4e-11 SNARE-like superfamily protein (.1)
Lus10012924 42 / 5e-05 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Potri.003G043200.1 pacid=42787458 polypeptide=Potri.003G043200.1.p locus=Potri.003G043200 ID=Potri.003G043200.1.v4.1 annot-version=v4.1
ATGGATTCCTTCCCGGTGGTGAAAAACATTCTTCTGCTAGACTCAGAAGGGAAGCGAGTTGCGGTCAAATACTATTCGGATGATTGGCCAACAAATTCTG
CAAAGTTAGCTTTTGAAAAATCTCTTTTTGCAAAGACTATGAAATCAAATGCTCGTACGGAAGCGGAGATTACAATGTTTGACAGCAACATTGTCATCTA
CAAATTTGTTCAGGATCTCCATTTCTATGTGACTGGGGGTGAGGACGAGAATGAACTCATCTTAGCTGCTGTTCTTCAGGGTTTCTTTGATTCAGTCTCT
CTCCTATTGAGGAGCAATGTTGACAAAAGGGAGGCACTTGAGAACTTAGATCTCATTTTCCTATGCCTTGATGAGATTGTTGAAAGAGGCATGATCCTAG
AAACAGATGCCAATGTTATTGCTGGAAAGGTGGCTGTAAATAGCATGGATCCTACTGCACCTCTATCAGAGCAGACTATAGGTCAAGCATTGGCTACAGC
TCGTGAACACTTGACGAGAACCCTTTTTCAGTAG
AA sequence
>Potri.003G043200.1 pacid=42787458 polypeptide=Potri.003G043200.1.p locus=Potri.003G043200 ID=Potri.003G043200.1.v4.1 annot-version=v4.1
MDSFPVVKNILLLDSEGKRVAVKYYSDDWPTNSAKLAFEKSLFAKTMKSNARTEAEITMFDSNIVIYKFVQDLHFYVTGGEDENELILAAVLQGFFDSVS
LLLRSNVDKREALENLDLIFLCLDEIVERGMILETDANVIAGKVAVNSMDPTAPLSEQTIGQALATAREHLTRTLFQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G60970 SNARE-like superfamily protein... Potri.003G043200 0 1
AT1G30630 Coatomer epsilon subunit (.1) Potri.011G155800 1.73 0.9634 COPE2.1
AT1G10630 ATARFA1F ADP-ribosylation factor A1F (.... Potri.014G116500 2.44 0.9627 Pt-ARF1.1
AT3G09740 ATSYP71, SYP71 syntaxin of plants 71 (.1) Potri.016G088200 2.82 0.9604 SYP71.2
AT4G11150 TUFF, EMB2448, ... embryo defective 2448, vacuola... Potri.019G029200 3.16 0.9604 VATE.1
AT1G09330 ECHIDNA, ECH unknown protein Potri.005G010400 4.24 0.9626
AT5G19050 alpha/beta-Hydrolases superfam... Potri.008G202300 4.89 0.9539
AT2G43640 Signal recognition particle, S... Potri.013G125200 5.09 0.9501
AT3G07950 rhomboid protein-related (.1) Potri.008G041100 6.00 0.9582
AT1G62510 Bifunctional inhibitor/lipid-t... Potri.001G121900 6.92 0.9406 Pt-HPS.3
AT1G42480 unknown protein Potri.005G253600 7.21 0.9280

Potri.003G043200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.