Potri.003G046951 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G40390 48 / 1e-06 DNAse I-like superfamily protein (.1)
AT1G43760 44 / 2e-05 DNAse I-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G047420 385 / 1e-138 AT1G40390 65 / 2e-12 DNAse I-like superfamily protein (.1)
Potri.004G128921 389 / 4e-137 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128880 389 / 4e-137 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128860 389 / 4e-137 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128961 389 / 4e-137 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128941 389 / 4e-137 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128901 389 / 4e-137 AT1G43760 149 / 3e-39 DNAse I-like superfamily protein (.1)
Potri.005G153775 379 / 4e-135 AT1G40390 94 / 1e-21 DNAse I-like superfamily protein (.1)
Potri.019G047975 381 / 6e-134 AT1G43760 157 / 3e-42 DNAse I-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016313 56 / 3e-09 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0530 DNase_I-like PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
Representative CDS sequence
>Potri.003G046951.1 pacid=42786044 polypeptide=Potri.003G046951.1.p locus=Potri.003G046951 ID=Potri.003G046951.1.v4.1 annot-version=v4.1
ATGATTATTGGATGTTGGAATATTAGAGGTTTGAATGATCCTATAAAGCATTCAGAATTGCGTCGGCTCATCCATCAAGAGAGGATAGCTCTTTTTGGTC
TGGTTGAAACTCGAGTTAAAGACAAGAATAAAGATAATGTTACTCAACTTCTTCTGCGTTCTTGGTCCTTCTTGTATAATTATGATTTCTCTTGTCGTGG
GCGTATTTGGATTTGTTGGAATGCTGATACGGTGAAGGTGGATGTTTTTGGAATGTCAGACCAGGCTATTCATGTTTCTGTCACTATATTAGCTACCAAT
ATCAGTTTCAATACTTCAATTATTTATGGAGACAATAATGCTTCCTTACGTGAGGCATTATGGTCTGATATTGTGAGTCGTAGTGATGGATGGGAGTCAA
CCCCGTGGATTCTTATGGGTGATTTTAATGCTATCCGCAACCAGTCGGACAGGTTAGGAGGGTCTACTACGTGGGCTGGTACTATGGACAGATTGGATAC
ATGTATTCGAGAAGCGAAAGTAGATGATCTTCGGTATTCAGGTATGCATTATACTTGGTCGAACTAA
AA sequence
>Potri.003G046951.1 pacid=42786044 polypeptide=Potri.003G046951.1.p locus=Potri.003G046951 ID=Potri.003G046951.1.v4.1 annot-version=v4.1
MIIGCWNIRGLNDPIKHSELRRLIHQERIALFGLVETRVKDKNKDNVTQLLLRSWSFLYNYDFSCRGRIWICWNADTVKVDVFGMSDQAIHVSVTILATN
ISFNTSIIYGDNNASLREALWSDIVSRSDGWESTPWILMGDFNAIRNQSDRLGGSTTWAGTMDRLDTCIREAKVDDLRYSGMHYTWSN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G40390 DNAse I-like superfamily prote... Potri.003G046951 0 1
Potri.010G072501 2.23 0.9222
AT1G43760 DNAse I-like superfamily prote... Potri.005G151275 3.87 0.9222
Potri.010G032101 5.19 0.6794
AT5G23760 Copper transport protein famil... Potri.015G144200 5.91 0.6200
AT4G18770 MYB ATMYB98 myb domain protein 98 (.1) Potri.005G118500 7.74 0.7123
AT5G57970 DNA glycosylase superfamily pr... Potri.001G044402 10.90 0.8195
AT5G22900 ATCHX3 cation/H+ exchanger 3, ARABIDO... Potri.006G176800 11.66 0.7908
AT1G62420 Protein of unknown function (D... Potri.011G023301 16.24 0.7026
AT2G19590 ATACO1, ACO1 ACC oxidase 1 (.1) Potri.006G151600 19.00 0.7180 ACO5
Potri.010G006700 19.44 0.7221

Potri.003G046951 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.