Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-PRO1.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29340 224 / 5e-77 PRF4 profilin 4 (.1) AT2G19770 223 / 2e-76 PRF5 profilin 5 (.1) AT2G19760 222 / 3e-76 PRF1, PFN1 profilin 1 (.1) AT5G56600 221 / 2e-75 PRF3, PFN3 profilin 3 (.1.2) AT4G29350 219 / 4e-75 PRF2, PFN2, PRO2 profilin 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G190800 [exp] 256 / 7e-90 AT2G19760 196 / 8e-66 profilin 1 (.1) Potri.018G057600 [exp] 240 / 2e-83 AT4G29340 188 / 5e-63 profilin 4 (.1) Potri.006G235200 [exp] 233 / 1e-80 AT4G29340 216 / 1e-73 profilin 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034988 [exp] 241 / 7e-84 AT4G29340 219 / 3e-75 profilin 4 (.1) Lus10037591 [exp] 240 / 2e-83 AT2G19770 231 / 6e-80 profilin 5 (.1) Lus10012936 [exp] 240 / 3e-83 AT4G29350 223 / 2e-76 profilin 2 (.1) Lus10006846 [exp] 238 / 1e-82 AT2G19770 229 / 5e-79 profilin 5 (.1) Lus10043040 [exp] 238 / 2e-82 AT5G56600 223 / 1e-76 profilin 3 (.1.2) Lus10011138 [exp] 238 / 2e-82 AT2G19760 225 / 2e-77 profilin 1 (.1) Lus10011139 [exp] 224 / 8e-77 AT4G29340 238 / 1e-82 profilin 4 (.1) Lus10034989 [exp] 222 / 3e-76 AT4G29340 234 / 6e-81 profilin 4 (.1) Lus10043041 [exp] 222 / 5e-76 AT4G29340 239 / 9e-83 profilin 4 (.1) Lus10012935 [exp] 220 / 2e-75 AT4G29340 235 / 2e-81 profilin 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [poplar] [flax] PF PF00235 [poplar] [flax] Profilin Profilin
Representative CDS sequence Show only first row Show all	>Potri.003G047700.1 pacid=42786498 polypeptide=Potri.003G047700.1.p locus=Potri.003G047700 ID=Potri.003G047700.1.v4.1 annot-version=v4.1 ATGTCGTGGCAAACATACGTTGATGATCACCTGATGTGCGACATCGAGGGTAACCATCTGACGGCTGCCGCCATCATCGGCCAAGATGGCAGTGTGTGGG CTCAGAGCGCCACTTTCCCTCAGTATAAGCCTGAGGAGATTTCTGCCATCATGAAAGATTTTGATGAACCTGGATCTCTAGCCCCAACTGGGTTGCACAT TGGTGGCACAAAGTACATGGTGATCCAGGGAGAGCCTGGAGCTGTGATTCGTGGAAAGAAGGGTTCTGGTGGCATCACTGTGAAGAAAACCGCCCAAGCT CTTATTTTTGGTATTTATGATGAGCCATTGACTCCAGGACAGTGTAACATGATAGTTGAGAGGTTGGGTGATTACCTCCTTGATCAGGGCCTGTAG
AA sequence Show only first row Show all	>Potri.003G047700.1 pacid=42786498 polypeptide=Potri.003G047700.1.p locus=Potri.003G047700 ID=Potri.003G047700.1.v4.1 annot-version=v4.1 MSWQTYVDDHLMCDIEGNHLTAAAIIGQDGSVWAQSATFPQYKPEEISAIMKDFDEPGSLAPTGLHIGGTKYMVIQGEPGAVIRGKKGSGGITVKKTAQA LIFGIYDEPLTPGQCNMIVERLGDYLLDQGL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G29340		PRF4	profilin 4 (.1)		Potri.003G047700 [exp]	0	1	Pt-PRO1.2
AT3G56930			DHHC-type zinc finger family p...		Potri.016G025100 [exp]	2.64	0.8535
AT2G45340			Leucine-rich repeat protein ki...		Potri.002G147000 [exp]	2.82	0.9051
AT3G56190		ASNAP, ALPHA-SN...	alpha-soluble NSF attachment p...		Potri.010G181900 [exp]	4.24	0.8888	ASNAP.3
AT3G54820		PIP2D, PIP2;5	PLASMA MEMBRANE INTRINSIC PROT...		Potri.010G222700 [exp]	9.38	0.8245	Pt-PIP2.3
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Potri.014G044000 [exp]	10.09	0.8893
AT3G06840			unknown protein		Potri.001G162100 [exp]	11.83	0.8785
AT5G58060		ATYKT61, ATGP1,...	SNARE-like superfamily protein...		Potri.006G187700 [exp]	14.69	0.8544
AT4G38660			Pathogenesis-related thaumatin...		Potri.002G020400 [exp]	22.47	0.8608
AT2G47930		AGP26, ATAGP26	ARABIDOPSIS THALIANA ARABINOGA...		Potri.002G207500 [exp]	24.37	0.8393
AT4G38650			Glycosyl hydrolase family 10 p...		Potri.004G173300 [exp]	32.31	0.8295

Compare expression of checked genes

Potri.003G047700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.