Potri.003G048150 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00600 56 / 5e-13 ATCG00600.1, PETG PETG (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02529 PetG Cytochrome B6-F complex subunit 5
Representative CDS sequence
>Potri.003G048150.1 pacid=42784758 polypeptide=Potri.003G048150.1.p locus=Potri.003G048150 ID=Potri.003G048150.1.v4.1 annot-version=v4.1
ATGATTGAAAATTTTCTATTTAGAATTGTCTTAGGTCTAATTCCTATTACTTTGGCTGGATTATTTGTAATTGCTTATTTACAATACAGATGTAGTGGAC
AGTTAAATCTTTAA
AA sequence
>Potri.003G048150.1 pacid=42784758 polypeptide=Potri.003G048150.1.p locus=Potri.003G048150 ID=Potri.003G048150.1.v4.1 annot-version=v4.1
MIENFLFRIVLGLIPITLAGLFVIAYLQYRCSGQLNL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00600 ATCG00600.1, PE... PETG (.1) Potri.003G048150 0 1
AT1G56200 EMB1303 embryo defective 1303 (.1.2) Potri.011G163900 7.93 0.9432
AT4G21860 MSRB2 methionine sulfoxide reductase... Potri.001G286500 10.58 0.9487
AT3G25810 Terpenoid cyclases/Protein pre... Potri.017G041700 15.19 0.9413
AT3G12345 unknown protein Potri.010G213600 18.00 0.9484
AT1G16080 unknown protein Potri.003G185501 19.59 0.9440
AT3G54210 Ribosomal protein L17 family p... Potri.006G113500 19.67 0.9486
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Potri.017G030600 20.44 0.9327
AT1G54500 Rubredoxin-like superfamily pr... Potri.005G049000 22.13 0.9473
AT2G38270 ATGRX2, CXIP2 GLUTAREDOXIN, CAX-interacting ... Potri.016G119200 23.15 0.9437
AT3G54210 Ribosomal protein L17 family p... Potri.016G143100 25.51 0.9439

Potri.003G048150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.