Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G16175 125 / 2e-37 Thioesterase superfamily protein (.1) AT2G29590 96 / 1e-25 Thioesterase superfamily protein (.1) AT1G52191 88 / 6e-23 Thioesterase superfamily protein (.1) AT1G04290 79 / 5e-19 Thioesterase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G042100 [exp] 84 / 4e-21 AT2G29590 177 / 8e-58 Thioesterase superfamily protein (.1) Potri.004G134066 [exp] 72 / 2e-16 AT1G04290 200 / 8e-67 Thioesterase superfamily protein (.1) Potri.004G134132 [exp] 69 / 2e-15 AT1G04290 166 / 2e-53 Thioesterase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006837 [exp] 192 / 2e-63 AT3G16175 114 / 5e-33 Thioesterase superfamily protein (.1) Lus10037583 [exp] 177 / 2e-57 AT3G16175 107 / 4e-30 Thioesterase superfamily protein (.1) Lus10006834 [exp] 174 / 2e-56 AT3G16175 102 / 4e-28 Thioesterase superfamily protein (.1) Lus10037582 [exp] 159 / 7e-50 AT3G16175 86 / 5e-21 Thioesterase superfamily protein (.1) Lus10018205 [exp] 100 / 2e-27 AT2G29590 206 / 6e-69 Thioesterase superfamily protein (.1) Lus10040701 [exp] 96 / 8e-26 AT2G29590 200 / 7e-67 Thioesterase superfamily protein (.1) Lus10004288 [exp] 76 / 5e-18 AT1G04290 226 / 5e-77 Thioesterase superfamily protein (.1) Lus10019228 [exp] 75 / 1e-17 AT1G04290 228 / 1e-77 Thioesterase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0050 [poplar] [flax] HotDog PF03061 [poplar] [flax] 4HBT Thioesterase superfamily
Representative CDS sequence Show only first row Show all	>Potri.003G051900.4 pacid=42784501 polypeptide=Potri.003G051900.4.p locus=Potri.003G051900 ID=Potri.003G051900.4.v4.1 annot-version=v4.1 ATGGAAGACAATCCAGTGCAGAGCTCCAATAGATGGCTTGAAGATCTCTCAAATGGTTTAGGCCACCAACTGGAGGCAATTACTCTTGAAGGTCTCAAAA TAGTGAAGGCACACAAGGGTTTCATACTCTGTAATTTTGTCGTTTCAAACCGCATATCAGATGCAGATGGGAATTGGCATGTTGGATCCATGGCAACGTT GATTGATGATGTGGGTGCAGCTGCTATTTACTCCTATGGTGGCCATGTCAAAGCATCTGTTGACCTCAACATCTCCTTTTTATCCACGGCTAAAATTCAA GAAGAAGTTGAAGTAGAGGCAAAGGTTGTGGGGGACAAGGGAAGGATAACATCAGTGCTCGTAGAGGTTAGAAGGAAAAGTAACGGGGAACTTATTGCTC TGGGAAAGCAATGGATGGCCTCACATAATAATTCAAATAAAGCCAGTAAGCTTTGA
AA sequence Show only first row Show all	>Potri.003G051900.4 pacid=42784501 polypeptide=Potri.003G051900.4.p locus=Potri.003G051900 ID=Potri.003G051900.4.v4.1 annot-version=v4.1 MEDNPVQSSNRWLEDLSNGLGHQLEAITLEGLKIVKAHKGFILCNFVVSNRISDADGNWHVGSMATLIDDVGAAAIYSYGGHVKASVDLNISFLSTAKIQ EEVEVEAKVVGDKGRITSVLVEVRRKSNGELIALGKQWMASHNNSNKASKL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G16175			Thioesterase superfamily prote...		Potri.003G051900 [exp]	0	1
					Potri.015G008200 [exp]	12.68	0.7334
AT5G47540			Mo25 family protein (.1)		Potri.006G014800 [exp]	13.19	0.7344
AT3G03980			NAD(P)-binding Rossmann-fold s...		Potri.019G033500 [exp]	19.23	0.7272
					Potri.017G061800 [exp]	19.41	0.7119
AT1G15860			Domain of unknown function (DU...		Potri.001G047900 [exp]	21.16	0.7063
AT4G20380		LSD1	LESION SIMULATING DISEASE, LSD...		Potri.001G442400 [exp]	23.34	0.7397	LSD1.1
AT5G22040			unknown protein		Potri.010G244600 [exp]	27.11	0.6630
AT1G77230			Tetratricopeptide repeat (TPR)...		Potri.002G076700 [exp]	29.69	0.7004
AT2G04230			FBD, F-box and Leucine Rich Re...		Potri.004G020200 [exp]	31.74	0.7287
AT5G11070			unknown protein		Potri.003G048200 [exp]	37.81	0.6579

Compare expression of checked genes

Potri.003G051900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.