Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G79870 444 / 5e-158 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT1G12550 275 / 2e-91 HPR3 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) AT2G45630 255 / 2e-83 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT4G34200 105 / 3e-25 EDA9 embryo sac development arrest 9, D-3-phosphoglycerate dehydrogenase (.1) AT1G17745 101 / 1e-23 PGDH D-3-phosphoglycerate dehydrogenase (.1.2) AT3G19480 98 / 2e-22 D-3-phosphoglycerate dehydrogenase (.1) AT1G68010 87 / 4e-19 ATHPR1, HPR hydroxypyruvate reductase (.1.2) AT1G72190 86 / 7e-19 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) AT5G28310 77 / 2e-16 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT5G14780 78 / 5e-16 FDH formate dehydrogenase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G183700 [exp] 412 / 2e-145 AT1G79870 404 / 3e-142 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073400 [exp] 271 / 3e-89 AT2G45630 405 / 2e-141 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151100 [exp] 270 / 5e-89 AT2G45630 400 / 3e-140 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073500 [exp] 265 / 2e-87 AT2G45630 377 / 4e-131 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151200 [exp] 261 / 6e-86 AT2G45630 382 / 3e-133 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.001G113250 [exp] 256 / 7e-84 AT1G12550 340 / 9e-117 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Potri.003G119000 [exp] 236 / 7e-76 AT2G45630 327 / 2e-111 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.013G046150 [exp] 173 / 1e-53 AT1G79870 164 / 3e-50 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G022800 [exp] 103 / 1e-24 AT3G19480 860 / 0.0 D-3-phosphoglycerate dehydrogenase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035866 [exp] 507 / 0 AT1G79870 466 / 6e-167 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10025796 [exp] 499 / 5e-180 AT1G79870 466 / 1e-166 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10025795 [exp] 423 / 1e-149 AT1G79870 438 / 6e-156 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10035867 [exp] 421 / 5e-149 AT1G79870 431 / 8e-153 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10037552 [exp] 408 / 8e-144 AT1G79870 410 / 6e-145 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10036537 [exp] 261 / 1e-85 AT2G45630 384 / 8e-134 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10041393 [exp] 255 / 1e-83 AT2G45630 392 / 7e-137 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10006708 [exp] 244 / 3e-79 AT1G12550 358 / 4e-124 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10014133 [exp] 229 / 2e-73 AT1G12550 340 / 1e-116 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10011442 [exp] 125 / 3e-35 AT1G79870 117 / 1e-32 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0325 [poplar] [flax] Form_Glyc_dh PF00389 [poplar] [flax] 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain CL0063 [poplar] [flax] NADP_Rossmann PF02826 [poplar] [flax] 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Representative CDS sequence Show only first row Show all	>Potri.003G052700.1 pacid=42786844 polypeptide=Potri.003G052700.1.p locus=Potri.003G052700 ID=Potri.003G052700.1.v4.1 annot-version=v4.1 ATGGAGTCCATAGGTGTCCTGATGACCTGCCCACCATTTGATCCTTACCTCGTCGAACAACTTGAGAAACGCTTCACTCTTTTCAAATTCCATTCCATTC CTGACAAAGCCCACTTCCTCAATTCCAACAAAGCCTCCATCCGCGCGGTCGTTGGCAACGCCAGTGCAGGCGCAGACGCACAGCTCATCCACCAGTTGCC CAACCTCGAAATCGTGTCCAGTTTCAGTGTTGGAATCGACAAGATTGACCTGGCCAAGTGTAGAGAGAGAGGTATCAGGGTCACTAATACCCCTGATGTT TTGACCGATGATGTTGCTGATTTGGCTATTGGGTTGATGTTGGCTGTCTTGAGGAGGCTTTGTCCGAGTGATCGCTATGTTAGGAGTGGTCAGTGGAAAA GGGGTGATTACAAGTTGACCACTAAGTTTACTGGGAAGTCAGTTGGCATTATTGGGTTGGGCAGGATTGGCCTGGCGATTGCCAAGAGAGCTGAAGCATT TAGTTGCCCAATTAGTTACCACACTAGAGCAGAGAAATCAGATGTAAAATACAAGTACTATCCTAGTGTTGTTGAGTTGGCTGCCAACTGTCAAATTCTC GTTGTTGCATGTGCATTAACTGAAGAAACTCGCCACATTATCAATCGTGAAGTCATCAATGCATTGGGTCCAAAGGGTGTCCTTATCAATATCGGTAGAG GTCCTCATGTTGATGAACCTGAGCTGGTTTCTGCACTAGTTGAAGGCCGGTTAGGCGGTGCTGGGCTCGACGTGTTTCAAGATGAACCTAATGTACCCGA GGAACTCTTTGGGCTTGAAAATGTAGTCCTCTTGCCTCATGTAGGGAGTGGCACCATGGAATCCAGGAAAGAAATGGCTGACCTTGTTGTTGGCAATTTG GAGGCGCACTTCTTAAACAAACCATTGTTAACTCCCGTGCTTTGA
AA sequence Show only first row Show all	>Potri.003G052700.1 pacid=42786844 polypeptide=Potri.003G052700.1.p locus=Potri.003G052700 ID=Potri.003G052700.1.v4.1 annot-version=v4.1 MESIGVLMTCPPFDPYLVEQLEKRFTLFKFHSIPDKAHFLNSNKASIRAVVGNASAGADAQLIHQLPNLEIVSSFSVGIDKIDLAKCRERGIRVTNTPDV LTDDVADLAIGLMLAVLRRLCPSDRYVRSGQWKRGDYKLTTKFTGKSVGIIGLGRIGLAIAKRAEAFSCPISYHTRAEKSDVKYKYYPSVVELAANCQIL VVACALTEETRHIINREVINALGPKGVLINIGRGPHVDEPELVSALVEGRLGGAGLDVFQDEPNVPEELFGLENVVLLPHVGSGTMESRKEMADLVVGNL EAHFLNKPLLTPVL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G79870			D-isomer specific 2-hydroxyaci...		Potri.003G052700 [exp]	0	1
AT5G63050		EMB2759	embryo defective 2759 (.1.2)		Potri.015G079700 [exp]	1.73	0.9587
AT3G54360			zinc ion binding (.1)		Potri.003G189400 [exp]	2.00	0.9615
AT1G64970		VTE4, TMT1, G-T...	VITAMIN E DEFICIENT 4, gamma-t...		Potri.013G077000 [exp]	5.91	0.9573
AT5G03555			permease, cytosine/purines, ur...		Potri.006G119500 [exp]	6.00	0.9544
AT4G25370			Double Clp-N motif protein (.1...		Potri.012G129800 [exp]	7.74	0.9595
AT4G14910		HISN5B, IGPD	HISTIDINE BIOSYNTHESIS 5B (.1....		Potri.010G087600 [exp]	12.36	0.9411
AT1G29700			Metallo-hydrolase/oxidoreducta...		Potri.008G117600 [exp]	12.96	0.9581
AT3G24800		PRT1	proteolysis 1 (.1)		Potri.001G049300 [exp]	16.97	0.9483
AT4G25370			Double Clp-N motif protein (.1...		Potri.015G131700 [exp]	18.16	0.9385
AT4G02340			alpha/beta-Hydrolases superfam...		Potri.002G202700 [exp]	18.97	0.9415

Compare expression of checked genes

Potri.003G052700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.