Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52240 151 / 2e-49 PIRF1, ATROPGEF11, ROPGEF11 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) AT3G16120 137 / 1e-43 Dynein light chain type 1 family protein (.1) AT4G27360 91 / 2e-25 Dynein light chain type 1 family protein (.1) AT5G20110 70 / 5e-16 Dynein light chain type 1 family protein (.1) AT1G23220 67 / 1e-15 Dynein light chain type 1 family protein (.1) AT4G15930 65 / 6e-15 Dynein light chain type 1 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G091800 [exp] 98 / 5e-28 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Potri.001G407900 [exp] 92 / 1e-25 AT4G27360 126 / 5e-39 Dynein light chain type 1 family protein (.1) Potri.011G126400 [exp] 89 / 3e-24 AT4G27360 117 / 2e-35 Dynein light chain type 1 family protein (.1) Potri.004G034000 [exp] 83 / 4e-22 AT4G27360 143 / 6e-46 Dynein light chain type 1 family protein (.1) Potri.008G133000 [exp] 70 / 6e-17 AT1G23220 204 / 3e-69 Dynein light chain type 1 family protein (.1) Potri.010G108700 [exp] 69 / 1e-16 AT1G23220 187 / 2e-62 Dynein light chain type 1 family protein (.1) Potri.008G219900 [exp] 66 / 3e-15 AT4G15930 154 / 1e-49 Dynein light chain type 1 family protein (.1) Potri.011G120400 [exp] 66 / 5e-15 AT1G23220 112 / 1e-32 Dynein light chain type 1 family protein (.1) Potri.003G108700 [exp] 63 / 9e-14 AT5G20110 116 / 4e-33 Dynein light chain type 1 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025794 [exp] 158 / 4e-52 AT1G52240 172 / 1e-57 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10035868 [exp] 156 / 3e-51 AT1G52240 174 / 2e-58 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10011443 [exp] 149 / 1e-48 AT1G52240 164 / 2e-54 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10037551 [exp] 139 / 2e-44 AT1G52240 157 / 2e-51 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10021496 [exp] 99 / 2e-28 AT1G52240 114 / 2e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10022596 [exp] 99 / 3e-28 AT1G52240 113 / 5e-34 phytochrome interacting RopGEF 1, RHO guanyl-nucleotide exchange factor 11 (.1.2) Lus10038566 [exp] 87 / 1e-23 AT4G27360 157 / 5e-51 Dynein light chain type 1 family protein (.1) Lus10034609 [exp] 71 / 8e-17 AT1G23220 181 / 4e-60 Dynein light chain type 1 family protein (.1) Lus10021793 [exp] 66 / 5e-15 AT1G23220 176 / 6e-58 Dynein light chain type 1 family protein (.1) Lus10014484 [exp] 64 / 2e-13 AT5G20110 191 / 2e-61 Dynein light chain type 1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01221 [poplar] [flax] Dynein_light Dynein light chain type 1
Representative CDS sequence Show only first row Show all	>Potri.003G052800.1 pacid=42785612 polypeptide=Potri.003G052800.1.p locus=Potri.003G052800 ID=Potri.003G052800.1.v4.1 annot-version=v4.1 ATGTTGGAAGGAAAAGCACTAATAGAAGACACAGACATGCCTTTGAAGATGCAAATCCAAGCCATGGCTTCTGCTTCTCAGGCCTTGGACCTCTATGATG TCCTGGATTGCAAATCCGTTGCTTCCCACATCAAAAAGGAGTTTGACCTGAGATATGGAGGTGGATGGCAATGTGTGGTGGGATCAAATTTTGGTTGTTT TTTCACTCATTCTAAAGGGACTTTCATCTACTTTACATTGGAGACACTCAATTTCCTAATCTTCAAAGGAGCTTCTTCTCCCTGA
AA sequence Show only first row Show all	>Potri.003G052800.1 pacid=42785612 polypeptide=Potri.003G052800.1.p locus=Potri.003G052800 ID=Potri.003G052800.1.v4.1 annot-version=v4.1 MLEGKALIEDTDMPLKMQIQAMASASQALDLYDVLDCKSVASHIKKEFDLRYGGGWQCVVGSNFGCFFTHSKGTFIYFTLETLNFLIFKGASSP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G52240		PIRF1, ATROPGEF...	phytochrome interacting RopGEF...		Potri.003G052800 [exp]	0	1
AT5G56550		ATOXS3	oxidative stress 3 (.1)		Potri.001G190700 [exp]	2.00	0.9092
AT2G43400		ETFQO	electron-transfer flavoprotein...		Potri.017G027500 [exp]	2.44	0.8756
AT4G33580		ATBCA5	A. THALIANA BETA CARBONIC ANHY...		Potri.005G156600 [exp]	10.58	0.8364
AT4G32300		SD2-5	S-domain-2 5 (.1)		Potri.004G014450 [exp]	13.49	0.8196
AT1G15670			Galactose oxidase/kelch repeat...		Potri.006G196900 [exp]	15.00	0.8736
AT5G52120		ATPP2-A14	phloem protein 2-A14 (.1)		Potri.012G136200 [exp]	15.87	0.8511
AT5G04040		SDP1	SUGAR-DEPENDENT1, Patatin-like...		Potri.006G043800 [exp]	18.33	0.8005
AT5G38280		PR5K	PR5-like receptor kinase (.1)		Potri.017G009400 [exp]	18.33	0.8405
AT3G17940			Galactose mutarotase-like supe...		Potri.017G129300 [exp]	18.76	0.8117
AT5G59080			unknown protein		Potri.009G038300 [exp]	19.39	0.8008

Compare expression of checked genes

Potri.003G052800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.