Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPL37.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52300 171 / 2e-57 Zinc-binding ribosomal protein family protein (.1) AT1G15250 168 / 3e-56 Zinc-binding ribosomal protein family protein (.1) AT3G16080 166 / 3e-55 Zinc-binding ribosomal protein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G183200 [exp] 188 / 4e-64 AT3G16080 172 / 8e-58 Zinc-binding ribosomal protein family protein (.1) Potri.018G036900 [exp] 172 / 8e-58 AT1G15250 167 / 1e-55 Zinc-binding ribosomal protein family protein (.1) Potri.006G243300 [exp] 169 / 1e-56 AT1G15250 170 / 1e-56 Zinc-binding ribosomal protein family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035878 [exp] 177 / 2e-58 AT3G16080 166 / 1e-53 Zinc-binding ribosomal protein family protein (.1) Lus10011446 [exp] 173 / 5e-58 AT3G16080 162 / 1e-53 Zinc-binding ribosomal protein family protein (.1) Lus10037549 [exp] 171 / 2e-57 AT3G16080 160 / 8e-53 Zinc-binding ribosomal protein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [poplar] [flax] Zn_Beta_Ribbon PF01907 [poplar] [flax] Ribosomal_L37e Ribosomal protein L37e
Representative CDS sequence Show only first row Show all	>Potri.003G053100.1 pacid=42785697 polypeptide=Potri.003G053100.1.p locus=Potri.003G053100 ID=Potri.003G053100.1.v4.1 annot-version=v4.1 ATGGGGAAGGGAACAGGGAGTTTTGGTAAGAGGAGGAACAAGACCCACACCCTCTGTGTTAGGTGTGGCCGCCGTAGCTTCCACCTCCAGAAGAGCCGTT GCTCCGCCTGTGCTTTCCCTGCTGCCCGCAAGAGGAAATACAACTGGAGTGAGAAGGCAATCAGGAGGAAGACAACTGGAACTGGAAGGATGAGGTATCT CCGCAATGTTCCTCGCAGGTTCAAGAGTGGTTTCAGAGAAGGCACTCAAGCAGAACCAAGGAAGAAGGGCACAGCGGCATCTGCTTAA
AA sequence Show only first row Show all	>Potri.003G053100.1 pacid=42785697 polypeptide=Potri.003G053100.1.p locus=Potri.003G053100 ID=Potri.003G053100.1.v4.1 annot-version=v4.1 MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCSACAFPAARKRKYNWSEKAIRRKTTGTGRMRYLRNVPRRFKSGFREGTQAEPRKKGTAASA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G16080			Zinc-binding ribosomal protein...		Potri.003G053100 [exp]	0	1	RPL37.2
AT3G49010		RSU2, ATBBC1	40S RIBOSOMAL PROTEIN, breast ...		Potri.003G102800 [exp]	2.00	0.9706	ATBBC1.3
AT4G00100		PFL2, ATRPS13A	POINTED FIRST LEAF 2, ribosoma...		Potri.012G128600 [exp]	3.16	0.9704	Pt-RPS13.2
AT5G61170			Ribosomal protein S19e family ...		Potri.017G092200 [exp]	4.00	0.9657	Pt-RPS19.2
AT3G11940		AML1, ATRPS5A	ARABIDOPSIS MINUTE-LIKE 1, rib...		Potri.006G197700 [exp]	4.24	0.9662	RPS5.2
AT5G39740		OLI7, RPL5B	OLIGOCELLULA 7, ribosomal prot...		Potri.019G099000 [exp]	4.89	0.9644
AT4G15000			Ribosomal L27e protein family ...		Potri.006G021500 [exp]	7.93	0.9460	Pt-RPL27.2
AT5G02610			Ribosomal L29 family protein ...		Potri.008G048800 [exp]	8.77	0.9629	RPL35.1
AT2G47110		UBQ6	ubiquitin 6 (.1.2)		Potri.001G025300 [exp]	9.53	0.9526	Pt-UBI.5
AT4G09800		RPS18C	S18 ribosomal protein (.1)		Potri.005G211200 [exp]	10.24	0.9649
AT5G09510			Ribosomal protein S19 family p...		Potri.010G076900 [exp]	11.22	0.9304	RPS15.2

Compare expression of checked genes

Potri.003G053100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.