Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52280 395 / 2e-142 AtRABG3d RAB GTPase homolog G3D (.1) AT3G16100 391 / 7e-141 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1) AT3G18820 378 / 2e-135 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1) AT1G49300 366 / 6e-131 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2) AT4G09720 313 / 8e-110 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4) AT1G22740 312 / 1e-109 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1) AT2G21880 276 / 4e-95 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2) AT5G39620 213 / 3e-70 AtRABG1 RAB GTPase homolog G1 (.1) AT2G44610 137 / 2e-40 RAB6, AtRABH1b, AtRab6A Ras-related small GTP-binding family protein (.1) AT1G28550 135 / 2e-39 AtRABA1i RAB GTPase homolog A1I (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G182900 [exp] 423 / 3e-153 AT3G16100 394 / 7e-142 RAB GTPase homolog G3C (.1) Potri.009G115000 [exp] 387 / 3e-139 AT3G18820 408 / 2e-147 RAB GTPase homolog G3F (.1) Potri.004G153400 [exp] 386 / 9e-139 AT3G18820 405 / 2e-146 RAB GTPase homolog G3F (.1) Potri.002G062400 [exp] 327 / 3e-115 AT4G09720 375 / 1e-134 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G198800 [exp] 314 / 4e-110 AT4G09720 370 / 2e-132 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G085300 [exp] 285 / 7e-99 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4) Potri.007G079700 [exp] 231 / 5e-78 AT4G09720 272 / 3e-94 RAB GTPase homolog G3A (.1.2.3.4) Potri.001G080400 [exp] 137 / 9e-41 AT1G02130 387 / 2e-139 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.001G152800 [exp] 135 / 4e-40 AT1G02130 382 / 2e-137 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035872 [exp] 412 / 5e-149 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1) Lus10040468 [exp] 380 / 3e-136 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1) Lus10042328 [exp] 346 / 8e-123 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1) Lus10023582 [exp] 317 / 9e-112 AT3G18820 330 / 4e-117 RAB GTPase homolog G3F (.1) Lus10028719 [exp] 296 / 4e-103 AT4G09720 341 / 5e-121 RAB GTPase homolog G3A (.1.2.3.4) Lus10006059 [exp] 282 / 9e-98 AT4G09720 323 / 4e-114 RAB GTPase homolog G3A (.1.2.3.4) Lus10025790 [exp] 270 / 6e-93 AT1G52280 257 / 5e-88 RAB GTPase homolog G3D (.1) Lus10043349 [exp] 133 / 4e-39 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10019501 [exp] 133 / 4e-39 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10004687 [exp] 131 / 5e-38 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.003G053400.1 pacid=42785194 polypeptide=Potri.003G053400.1.p locus=Potri.003G053400 ID=Potri.003G053400.1.v4.1 annot-version=v4.1 ATGGCTTCTCGCAGACGCATGCTCTTGAAGGTTATAATTCTCGGTGACAGCGGGGTAGGCAAGACATCGCTGATGAATCAGTATGTGAATCGAAAGTTCA GTAATCAATACAAGGCAACAATAGGAGCTGACTTTTTAACCAAAGAAGTTCAGTTTGAGGATAGAATGTTCACATTACAGATATGGGATACTGCAGGACA AGAGAGGTTTCAAAGTCTTGGAGTGGCTTTCTATCGTGGCGCGGACTGCTGTGTTCTTGTGTATGATGTGAATGTCATGAAGTCATTTGACAATCTTAAC AATTGGAGAGAGGAGTTTCTGATTCAGGCAAGTCCATCTGACCCTGAAAACTTCCCATTTGTTGTGTTGGGGAACAAGATAGATGTTGATGGAGGCAATA GTCGAGTGGTTTCTGAGAAGAAAGCAAAGGCATGGTGTGCTGCTAAGGGAAACATACCCTACTTTGAGACTTCTGCAAAAGAAGGTTTCAATGTGGATGC TGCATTTCAGTGTATAGCCAAAAATGCGCTTAAGAATGAACCTGAAGAAGAAATATACCTTCCTGACACCATCGATGTTGGGGGTGGGGGGCGACAACAA ACTTCCACCGGTTGCGAATGTTGA
AA sequence Show only first row Show all	>Potri.003G053400.1 pacid=42785194 polypeptide=Potri.003G053400.1.p locus=Potri.003G053400 ID=Potri.003G053400.1.v4.1 annot-version=v4.1 MASRRRMLLKVIILGDSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRMFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDNLN NWREEFLIQASPSDPENFPFVVLGNKIDVDGGNSRVVSEKKAKAWCAAKGNIPYFETSAKEGFNVDAAFQCIAKNALKNEPEEEIYLPDTIDVGGGGRQQ TSTGCEC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G52280		AtRABG3d	RAB GTPase homolog G3D (.1)		Potri.003G053400 [exp]	0	1
AT2G21600		ATRER1B	endoplasmatic reticulum retrie...		Potri.005G228900 [exp]	1.00	0.8498	RER1.4
AT4G15800		RALFL33	ralf-like 33 (.1)		Potri.005G025800 [exp]	2.23	0.8001	RALFL23.2
AT2G06530		VPS2.1	SNF7 family protein (.1)		Potri.001G170400 [exp]	2.44	0.8100
AT2G14110			Haloacid dehalogenase-like hyd...		Potri.017G043700 [exp]	6.00	0.8091
AT5G25265			unknown protein		Potri.006G258800 [exp]	7.07	0.7331
AT3G06760			Drought-responsive family prot...		Potri.011G057200 [exp]	8.48	0.7713
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Potri.014G113900 [exp]	8.60	0.7202
AT2G42500		PP2A-3, PP2A-4	protein phosphatase 2A-3 (.1.2...		Potri.003G217900 [exp]	9.38	0.7652	Pt-PP2.3
AT1G51200			A20/AN1-like zinc finger famil...		Potri.016G051700 [exp]	10.81	0.7817
AT5G53300		UBC10	ubiquitin-conjugating enzyme 1...		Potri.015G023300 [exp]	10.95	0.7544	Pt-UBC.4

Compare expression of checked genes

Potri.003G053400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.