Potri.003G054601 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G79910 141 / 2e-37 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G52315 119 / 1e-29 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G32350 120 / 9e-29 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G35730 97 / 2e-21 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G25420 78 / 6e-16 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT1G34220 79 / 2e-15 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT4G29440 67 / 2e-11 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G19710 65 / 8e-11 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT2G14830 59 / 3e-09 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G13340 58 / 7e-09 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G054500 790 / 0 AT1G79910 216 / 4e-65 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.003G054700 723 / 0 AT1G79910 141 / 1e-37 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.001G181300 555 / 0 AT1G79910 244 / 1e-75 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.018G079500 144 / 4e-37 AT4G32350 240 / 1e-69 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.007G059800 91 / 2e-19 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.008G121300 78 / 1e-15 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.006G149800 77 / 2e-14 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.019G087400 76 / 2e-14 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.004G038600 74 / 8e-14 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035885 182 / 8e-52 AT1G79910 235 / 1e-72 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10025932 171 / 4e-46 AT5G48840 440 / 2e-149 ARABIDOPSIS THALIANA PANTOTHENATE SYNTHETASE, homolog of bacterial PANC (.1)
Lus10011455 162 / 2e-45 AT1G79910 233 / 1e-73 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10025779 166 / 3e-45 AT1G79910 199 / 8e-59 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10037536 152 / 1e-41 AT1G79910 191 / 2e-57 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10034905 141 / 5e-36 AT4G32350 256 / 3e-75 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10023635 140 / 1e-35 AT4G32350 252 / 9e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041836 82 / 2e-16 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10038167 82 / 2e-16 AT5G48840 447 / 7e-155 ARABIDOPSIS THALIANA PANTOTHENATE SYNTHETASE, homolog of bacterial PANC (.1)
Lus10028383 79 / 2e-15 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Potri.003G054601.1 pacid=42785489 polypeptide=Potri.003G054601.1.p locus=Potri.003G054601 ID=Potri.003G054601.1.v4.1 annot-version=v4.1
ATGATAATCTATTACAATTTCATTGAGCAGCTCTGTGATTGCATCTCGAGCAATCTTTCCCTTATGAACAAACAGAAGGAATGCCCCGAGGAATGCAAAG
AAGCTGTGCAATCTCTAATATATGCTGCAGCAAGATTTTCTGAATTTCCAGAGCTACGAGATCTTCGTTCTGAATTCATTAATAGATATGGACCTCCTCT
TGAAGCATTAGTTAATAAAGAGTTTGTTGACATGTTGAAGCCGAAGTCTATCACAGAAGAGATGAAGCTTCAATTAATGCACGACATAGCACTAGAGTTC
TCCATAGAATGGAATTCAAAGTCTTTGGAACAGAAACTCTTTAAACCACCTCCGCCTCAACAAGACCAGCATAGGCATGAACATAATGATGAATATGAGC
CGAAGAAGAGCAAGGATGACGCTTTTAGCTTGAATGATGATGACGGATACAAATGGGTAAAGAACAAGGATGATGCTTGCACAAAAAGAGACAGCCATGA
CTTGGCCAACAAAGTACATGACAAGAGGGAGCATACCTTCCAGGAAAGAGATGATGAAAGGATTTTCACTTATCGAGGAAGACAGAATGCCAGTGATGAA
AAATACAAACTGCAAAGCAGCAGTGAAGATGAAGTGTTTTCAGTCAGCAGGAGAGACAGCACTGACCAAGATAGCCTACTAGCTAGTTCAAGTTCAGTAG
GAAGTGTTTCAGAAGATGAAGTAGATAGCAAGAAGCCCATTCCCTATAGATTTATTCCTCCCCCTTACCGCAGAACAACAATTGAGAAAGAAAGCAAGAT
CGAAGAAACCCTACAACCAAATGATAAAATAGCTGCAGAGGAAGCAAATCATCCAGATGACTCGATCAAGGAAACCAAGCCCAAACCGAGATCAGTCAGA
AGTAGACCATTGAAGCCACAACCAGGACACGAAAATTTTGGCAGTATTGAAAGACCGTTGAAGCCACCGTCAGGTCGTGAAAGGGTTGGCAGTATAAGCG
ATGAGTCTGCCAGGACTAAATCAAGTGCAATGAAGCAAGAAGAGCCTAGACGAGGTTCTAGAATCCTAAAAACAGATGATGATGAAAGGGATGAAGAAGA
AAAGGTAAAGGATGGACTTTTGATGCATTACGGTAAGAAAGACTCACCTCATGAACCGAGCAAATCGAGTCCTTGTATAAAACCTCCTCCTTCAAGCCAA
GCAAGTGATGATGCTGCTAAAACCTCAAGGCTCAGAAGTGTAATATCCGAATTAACTCTTCCAACTGGCAGAACATCAAGCCTGCGAGAACCAGGAACAA
CAAGGCTTGGTCGAGCTGTTTCAGCAGAGCCGGATATAATGACTGGTCGTGTGCATCCCAACCTCCCAGATTGTGATGAATTGGCAGCTCGGATTGCAGC
TCTTAAGGGAAGATAA
AA sequence
>Potri.003G054601.1 pacid=42785489 polypeptide=Potri.003G054601.1.p locus=Potri.003G054601 ID=Potri.003G054601.1.v4.1 annot-version=v4.1
MIIYYNFIEQLCDCISSNLSLMNKQKECPEECKEAVQSLIYAAARFSEFPELRDLRSEFINRYGPPLEALVNKEFVDMLKPKSITEEMKLQLMHDIALEF
SIEWNSKSLEQKLFKPPPPQQDQHRHEHNDEYEPKKSKDDAFSLNDDDGYKWVKNKDDACTKRDSHDLANKVHDKREHTFQERDDERIFTYRGRQNASDE
KYKLQSSSEDEVFSVSRRDSTDQDSLLASSSSVGSVSEDEVDSKKPIPYRFIPPPYRRTTIEKESKIEETLQPNDKIAAEEANHPDDSIKETKPKPRSVR
SRPLKPQPGHENFGSIERPLKPPSGRERVGSISDESARTKSSAMKQEEPRRGSRILKTDDDERDEEEKVKDGLLMHYGKKDSPHEPSKSSPCIKPPPSSQ
ASDDAAKTSRLRSVISELTLPTGRTSSLREPGTTRLGRAVSAEPDIMTGRVHPNLPDCDELAARIAALKGR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G79910 Regulator of Vps4 activity in ... Potri.003G054601 0 1
AT1G79910 Regulator of Vps4 activity in ... Potri.003G054500 1.00 0.9355
AT1G79910 Regulator of Vps4 activity in ... Potri.003G054700 3.00 0.8514
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Potri.018G021900 6.48 0.7588
AT4G12110 ATSMO1-1, SMO1-... sterol-4alpha-methyl oxidase 1... Potri.001G116500 8.48 0.7472 SMO1.2
AT5G12330 LRP1 LATERAL ROOT PRIMORDIUM 1, Lat... Potri.001G027700 9.79 0.7402
AT3G07500 FAR1_related Far-red impaired responsive (F... Potri.007G128900 13.85 0.7474
AT5G46570 BSK2 BR-signaling kinase 2 (.1) Potri.003G088900 18.02 0.7639
AT2G01950 VH1, BRL2 VASCULAR HIGHWAY 1, BRI1-like ... Potri.010G101100 22.60 0.7557
AT5G42340 PUB15 Plant U-Box 15 (.1) Potri.004G205000 22.80 0.7025
AT1G71830 ATSERK1, SERK1 somatic embryogenesis receptor... Potri.005G083300 24.67 0.7086

Potri.003G054601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.