Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G25735 39 / 0.0001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G180500 [exp] 176 / 2e-58 AT2G25735 40 / 3e-05 unknown protein Potri.018G036300 [exp] 75 / 9e-19 AT2G25735 51 / 1e-09 unknown protein Potri.006G244200 [exp] 65 / 6e-15 AT2G25735 49 / 1e-08 unknown protein Potri.003G101300 [exp] 39 / 0.0001 AT5G14890 125 / 6e-34 NHL domain-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007679 [exp] 49 / 8e-09 AT2G25735 53 / 1e-10 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G055100.1 pacid=42785880 polypeptide=Potri.003G055100.1.p locus=Potri.003G055100 ID=Potri.003G055100.1.v4.1 annot-version=v4.1 ATGGCATGGTGCAACTCAGGCAGTCGAAACATGAATAGCTACGCAAAAAGGGGGTATGATCGGATTGGGTCATTTAAAACACTGGTCAGTCATGAATCAA AGTCACCAAGGTGGAGATTATTGTGGAAGAAGATAGTGAAGGAAAAAAGAAAGATTTTTTACTGTTCATCGTCGGCTCAGGCTAATATTACTTATGATCC CTACACGTACTCTCAGAATTTTGATCACGGCTTGATCATGTCCAACCCTGATGACAGCTCCCGGTCTTTCTCGGCTAGGTTTCCCGTCCCTTCAAGGATC TTTGAGAAAGGTGGATTGGTATAG
AA sequence Show only first row Show all	>Potri.003G055100.1 pacid=42785880 polypeptide=Potri.003G055100.1.p locus=Potri.003G055100 ID=Potri.003G055100.1.v4.1 annot-version=v4.1 MAWCNSGSRNMNSYAKRGYDRIGSFKTLVSHESKSPRWRLLWKKIVKEKRKIFYCSSSAQANITYDPYTYSQNFDHGLIMSNPDDSSRSFSARFPVPSRI FEKGGLV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G25735			unknown protein		Potri.003G055100 [exp]	0	1
AT5G18970			AWPM-19-like family protein (....		Potri.008G200300 [exp]	4.89	0.9696
AT3G20570		AtENODL9	early nodulin-like protein 9 (...		Potri.011G135400 [exp]	6.78	0.9690
AT3G17730	NAC	ANAC057	NAC domain containing protein ...		Potri.012G038100 [exp]	9.16	0.9667	NAC020
AT1G54860			Glycoprotein membrane precurso...		Potri.005G034300 [exp]	10.77	0.9655
AT5G22870			Late embryogenesis abundant (L...		Potri.009G003800 [exp]	10.95	0.9649
AT5G62940	DOF	AtDof5.6, HCA2	HIGH CAMBIAL ACTIVITY2, DNA BI...		Potri.012G081300 [exp]	11.22	0.9477
AT4G05220			Late embryogenesis abundant (L...		Potri.004G023300 [exp]	12.40	0.9543
AT1G54400			HSP20-like chaperones superfam...		Potri.013G054700 [exp]	13.41	0.9627
AT3G17380			TRAF-like family protein (.1)		Potri.008G005300 [exp]	15.87	0.9613
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Potri.010G050200 [exp]	18.43	0.9481

Compare expression of checked genes

Potri.003G055100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.