Potri.003G055900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47540 153 / 4e-46 Mo25 family protein (.1)
AT4G17270 143 / 3e-42 Mo25 family protein (.1)
AT2G03410 122 / 2e-34 Mo25 family protein (.1)
AT5G18940 66 / 4e-13 Mo25 family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G057100 207 / 8e-67 AT5G47540 411 / 5e-144 Mo25 family protein (.1)
Potri.006G014800 176 / 6e-55 AT5G47540 569 / 0.0 Mo25 family protein (.1)
Potri.010G155300 169 / 2e-53 AT5G47540 348 / 6e-121 Mo25 family protein (.1)
Potri.010G155400 169 / 3e-52 AT5G47540 588 / 0.0 Mo25 family protein (.1)
Potri.016G011100 169 / 3e-52 AT5G47540 589 / 0.0 Mo25 family protein (.1)
Potri.016G011300 123 / 2e-36 AT5G47540 262 / 1e-88 Mo25 family protein (.1)
Potri.002G222800 105 / 1e-27 AT5G47540 458 / 1e-162 Mo25 family protein (.1)
Potri.014G162100 103 / 1e-26 AT5G47540 461 / 1e-162 Mo25 family protein (.1)
Potri.008G198900 64 / 1e-12 AT5G18940 436 / 5e-154 Mo25 family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039045 162 / 9e-50 AT5G47540 517 / 0.0 Mo25 family protein (.1)
Lus10027342 162 / 1e-49 AT5G47540 592 / 0.0 Mo25 family protein (.1)
Lus10010497 160 / 6e-49 AT5G47540 594 / 0.0 Mo25 family protein (.1)
Lus10017565 160 / 7e-49 AT5G47540 593 / 0.0 Mo25 family protein (.1)
Lus10036523 95 / 2e-23 AT5G47540 446 / 1e-156 Mo25 family protein (.1)
Lus10041405 89 / 3e-21 AT5G47540 446 / 3e-157 Mo25 family protein (.1)
Lus10034014 59 / 1e-10 AT5G18940 522 / 0.0 Mo25 family protein (.1.2)
Lus10012762 49 / 3e-07 AT5G18940 512 / 0.0 Mo25 family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF08569 Mo25 Mo25-like
Representative CDS sequence
>Potri.003G055900.1 pacid=42786535 polypeptide=Potri.003G055900.1.p locus=Potri.003G055900 ID=Potri.003G055900.1.v4.1 annot-version=v4.1
ATGGCTAAACATATCAGGGCTTTAAAGTCAATTGTTGATGACAATGATGAGTCTTATGCAGTCCAAAAAGCCTTCGCACAATTGACAGAGGAGTTCTTCA
GAGAGAACACACTTCTTCTCATCGTTTGTCTTCTGAAATTGACCTTGGAGGTCCAAAGAGATGCCACTCAAGTTGTTGCAAATCTACGAAGGCAGAAAGT
TCAGTTGCGATTGATTGCCTCAGAATACTTGCAGAAAAACACCGATGTTTTAGATCTTTTGGTAGCAGGTTGTGGAAACATAGACATGGCTAACCATTAC
GGTGAAATGATGATAGCGTGTTTGCGTCACCAGAGTGCTGCAAGATATGTTCTAGAATCACCAGTACATCTGAAGAAGTTCTTTGATTATATACAGCTTC
TGAATTCCGACGTTGCGGCAGATGATGCCTTAACTCTTAAGGAACTAATTGACAAGGCATACTGA
AA sequence
>Potri.003G055900.1 pacid=42786535 polypeptide=Potri.003G055900.1.p locus=Potri.003G055900 ID=Potri.003G055900.1.v4.1 annot-version=v4.1
MAKHIRALKSIVDDNDESYAVQKAFAQLTEEFFRENTLLLIVCLLKLTLEVQRDATQVVANLRRQKVQLRLIASEYLQKNTDVLDLLVAGCGNIDMANHY
GEMMIACLRHQSAARYVLESPVHLKKFFDYIQLLNSDVAADDALTLKELIDKAY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G47540 Mo25 family protein (.1) Potri.003G055900 0 1
Potri.001G221051 8.88 0.9709
Potri.006G034450 13.19 0.9863
Potri.012G082350 13.60 0.9985
Potri.008G172250 18.08 0.9502
Potri.006G062050 21.93 0.9985
AT3G50940 P-loop containing nucleoside t... Potri.001G392300 22.97 0.9242
AT4G09510 A/N-InvI, CINV2 alkaline/neutral invertase I, ... Potri.002G173600 23.49 0.9222
AT4G27670 HSP21 heat shock protein 21 (.1) Potri.015G005801 24.97 0.9936
AT1G06280 AS2 LBD2 LOB domain-containing protein ... Potri.013G123900 25.07 0.9985
Potri.014G065951 25.49 0.9934

Potri.003G055900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.