Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G79990 223 / 4e-76 structural molecules (.1.2.3.4.5)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G179500 [exp] 259 / 2e-90 AT1G79990 222 / 1e-75 structural molecules (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011465 [exp] 156 / 8e-45 AT1G10050 807 / 0.0 glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10037528 [exp] 143 / 5e-40 AT1G58370 1064 / 0.0 ARABIDOPSIS THALIANA XYLANASE 1, glycosyl hydrolase family 10 protein / carbohydrate-binding domain-containing protein (.1) Lus10035895 [exp] 125 / 5e-38 AT1G79990 125 / 8e-35 structural molecules (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09801 [poplar] [flax] SYS1 Integral membrane protein S linking to the trans Golgi network
Representative CDS sequence Show only first row Show all	>Potri.003G056100.5 pacid=42785219 polypeptide=Potri.003G056100.5.p locus=Potri.003G056100 ID=Potri.003G056100.5.v4.1 annot-version=v4.1 ATGTTCTATGGTGCATTGGTATGGGATCCATGGCTAATAGTAGCCCAAATTGTCTGCCTTCAGTGCCTTTACTATCTCACCCTTGGTTTCTTTTTATCCC TTCTTGTTGGCACTCGCGTCTCTCACTTGACTCTCGTTTATTTCTTTGATTTCGCCACTATCACTACCTCTACTGTCACCGGCTGCTGTGTCATTGCCTC CCTTCTCCTCACCTCCTTTGCTGGAGCTGGGTATATGTTGTTTTTTATTGAGAGGGCAAATAAGTGCTTAGATTTTTCGGCAACCCTCTATATCATCCAT TTGTTGAAATGCATGATATATGGAGGTTGGCCTTCCTCGATAACATGGTGGGTTGTTAATGGTACTGGATTTGCAGTGATGGCCTTGCTTGGTGAATATT TGTGTATCAAGCGTGAACTCCGGGAGATTCCCACACGATATCGATCCAATGTTTGA
AA sequence Show only first row Show all	>Potri.003G056100.5 pacid=42785219 polypeptide=Potri.003G056100.5.p locus=Potri.003G056100 ID=Potri.003G056100.5.v4.1 annot-version=v4.1 MFYGALVWDPWLIVAQIVCLQCLYYLTLGFFLSLLVGTRVSHLTLVYFFDFATITTSTVTGCCVIASLLLTSFAGAGYMLFFIERANKCLDFSATLYIIH LLKCMIYGGWPSSITWWVVNGTGFAVMALLGEYLCIKRELREIPTRYRSNV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G79990			structural molecules (.1.2.3.4...		Potri.003G056100 [exp]	0	1
AT3G22970			Protein of unknown function (D...		Potri.005G216900 [exp]	1.00	0.9389
AT5G38560		AtPERK8	proline-rich extensin-like rec...		Potri.004G105200 [exp]	5.29	0.8933
AT5G62580			ARM repeat superfamily protein...		Potri.015G069200 [exp]	6.00	0.9228
AT1G29200			O-fucosyltransferase family pr...		Potri.011G068300 [exp]	6.78	0.9304
AT2G01660		PDLP6	plasmodesmata-located protein ...		Potri.010G108100 [exp]	6.92	0.9099
AT5G62700		atgcp3, TUB3	tubulin beta chain 3 (.1)		Potri.001G272700 [exp]	8.48	0.9247
AT5G46860		SGR3, ATVAM3, A...	SHOOT GRAVITROPISM 3, ARABIDOP...		Potri.001G138500 [exp]	9.79	0.8893	Pt-SYP23.2
AT3G15430			Regulator of chromosome conden...		Potri.011G121900 [exp]	10.72	0.8594
AT1G10720			BSD domain-containing protein ...		Potri.014G014200 [exp]	14.73	0.9105
AT2G16400	HD	BLH7	BEL1-like homeodomain 7 (.1)		Potri.002G031000 [exp]	14.83	0.9069

Compare expression of checked genes

Potri.003G056100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.