Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15520 484 / 3e-160 ATABCG40, ABCG40, PDR12, ATPDR12 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) AT2G36380 450 / 3e-147 ABCG34, PDR6, ATPDR6 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1) AT1G66950 449 / 4e-147 ABCG39, PDR11, ATPDR11 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) AT3G30842 448 / 6e-147 ABCG38, PDR10, ATPDR10 ATP-binding cassette G38, pleiotropic drug resistance 10 (.1) AT1G15210 441 / 8e-144 ABCG35, PDR7, ATPDR7 ATP-binding cassette G35, pleiotropic drug resistance 7 (.1) AT1G59870 431 / 3e-140 ATABCG36, ABCG36, PEN3, PDR8, ATPDR8 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) AT3G16340 428 / 3e-139 ABCG29, ATPDR1, PDR1, AtABCG29 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) AT2G26910 412 / 3e-133 PEC1, ABCG32, PDR4, ATPDR4 PERMEABLE CUTICLE 1, ATP-binding cassette G32, pleiotropic drug resistance 4 (.1) AT2G29940 405 / 2e-130 ABCG31, PDR3, ATPDR3 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) AT2G37280 402 / 1e-129 ABCG33, PDR5, ATPDR5 ATP-binding cassette G33, pleiotropic drug resistance 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G175700 [exp] 536 / 9e-180 AT1G15520 2058 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.003G183200 [exp] 514 / 1e-171 AT1G15520 2031 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.018G032900 [exp] 508 / 3e-169 AT1G15520 2041 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.006G248500 [exp] 504 / 9e-168 AT1G15520 2050 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.003G179000 [exp] 494 / 5e-164 AT1G15520 2010 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G048800 [exp] 493 / 9e-164 AT1G15520 2034 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.003G178900 [exp] 493 / 2e-163 AT1G15520 2000 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G048700 [exp] 492 / 4e-163 AT1G15520 2000 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G048900 [exp] 485 / 2e-160 AT1G15520 2055 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041685 [exp] 493 / 6e-169 AT1G15520 1271 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10008090 [exp] 499 / 1e-165 AT1G15520 2045 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10041668 [exp] 496 / 8e-165 AT1G15520 2128 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10024060 [exp] 491 / 4e-163 AT1G15520 2115 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10027727 [exp] 470 / 1e-162 AT1G66950 974 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Lus10024061 [exp] 489 / 3e-162 AT1G15520 2139 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10034020 [exp] 487 / 1e-161 AT1G15520 2029 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10008984 [exp] 451 / 2e-147 AT2G36380 2007 / 0.0 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1) Lus10014384 [exp] 448 / 8e-147 AT1G66950 1917 / 0.0 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) Lus10041683 [exp] 442 / 5e-145 AT1G15520 2019 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00005 [poplar] [flax] ABC_tran ABC transporter CL0023 [poplar] [flax] PF14510 [poplar] [flax] ABC_trans_N ABC-transporter N-terminal
Representative CDS sequence Show only first row Show all	>Potri.003G057250.1 pacid=42784778 polypeptide=Potri.003G057250.1.p locus=Potri.003G057250 ID=Potri.003G057250.1.v4.1 annot-version=v4.1 ATGTGTTACAGAGTGGGAATAGAAATTCCCACAGTGGAAGTCAGATTTGAGCATCTAAATGTTGAAACTGAAGTTTATCTAGGAAGCAGAGCTCTGCCTA CAATTTTCAACTCTTTTGCCAATATAGTAGAGGGATCCTTAAACTATCTCCGAATGCTGCCTACTAGAAAGAAACGGATGCATATCCTGAATGATGTGAG TGGAATAATCAAGCCTTGCAGAATGACATTGCTTTTAGGTCCACCAGGTTCTGGAAAGACTACTCTGCTGTTGGCTTTGGCAGGAAAGCTTCCCAATAAC CTGGAGTATTCGGGGAGGGTGACTTACAATGGCCACGAGATGAATGAGTTTGTGCCCCAGAGAACTGCTGCCTACATCAGTCAACATGACCTTCATTTAG CTGAAATGACTGTACGAGAAACATTATCATTCTCTGCAAGATGTCAGGGAACTGGAGCCCGTTATGAGATGTTGGCCGAATTGTTAAGACGAGAGAAAGC AGCTGGCATTAAGCCTGATCCTGACCTTGATGTGTTCATGAAGGCAGCATCAGTAGGGGGCCAAGAGACGAGTGTGATCACAGATTACATCCTGAAGGTT TTGGGACTAGAAGCTTGTGCTGATACCATGCTAGGGGACGAATTGCTTAGGGGTGTCTCAGGGGGGCAAAAGAAGCGAGTAACAACAGGTGAGATGCTTG TTGGTTCAGCAAAGGTGCTGTTAATGGATGAGATATCTACTGGTTTGGACAGCTCGACAACATTTCAGATAATGAACTCACTCAAGCAATGCATTTGTAT TCTTAATGGAACCGCTTTCATTTCTCTCCTCCAGCCAGTACCAGAGACTTATGATCTCTTTGATGACATTATTCTCCTCTCTGATGGACATATTGTGTAC CAAGGTCCCCGTGGACACGTGCTAGAATTTTTTGAATCGATGGGCTTCAAGTGCCCTGAAAGAAAAGGAGTGGCTGACTTCTTGCAAGAAGTTACATCAA GGAAAGATTAG
AA sequence Show only first row Show all	>Potri.003G057250.1 pacid=42784778 polypeptide=Potri.003G057250.1.p locus=Potri.003G057250 ID=Potri.003G057250.1.v4.1 annot-version=v4.1 MCYRVGIEIPTVEVRFEHLNVETEVYLGSRALPTIFNSFANIVEGSLNYLRMLPTRKKRMHILNDVSGIIKPCRMTLLLGPPGSGKTTLLLALAGKLPNN LEYSGRVTYNGHEMNEFVPQRTAAYISQHDLHLAEMTVRETLSFSARCQGTGARYEMLAELLRREKAAGIKPDPDLDVFMKAASVGGQETSVITDYILKV LGLEACADTMLGDELLRGVSGGQKKRVTTGEMLVGSAKVLLMDEISTGLDSSTTFQIMNSLKQCICILNGTAFISLLQPVPETYDLFDDIILLSDGHIVY QGPRGHVLEFFESMGFKCPERKGVADFLQEVTSRKD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Potri.003G057250 [exp]	0	1
AT5G34883			Protein of unknown function (D...		Potri.017G039175 [exp]	2.44	0.9435
					Potri.006G177125 [exp]	9.79	0.8758
					Potri.001G076350 [exp]	17.49	0.8733
					Potri.007G036901 [exp]	30.24	0.8039
AT1G78950		ATLUP3	Terpenoid cyclases family prot...		Potri.019G079150 [exp]	33.94	0.8336
AT4G27290			S-locus lectin protein kinase ...		Potri.001G412700 [exp]	37.46	0.8496
AT4G00350			MATE efflux family protein (.1...		Potri.017G016450 [exp]	40.79	0.7735
AT4G28670			Protein kinase family protein ...		Potri.007G056000 [exp]	41.83	0.8293
AT2G27240			Aluminium activated malate tra...		Potri.001G217050 [exp]	46.47	0.8195
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Potri.003G057301 [exp]	50.95	0.8920

Compare expression of checked genes

Potri.003G057250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.