Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15520 343 / 2e-109 ATABCG40, ABCG40, PDR12, ATPDR12 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) AT2G26910 295 / 8e-92 PEC1, ABCG32, PDR4, ATPDR4 PERMEABLE CUTICLE 1, ATP-binding cassette G32, pleiotropic drug resistance 4 (.1) AT2G29940 288 / 2e-89 ABCG31, PDR3, ATPDR3 ATP-binding cassette G31, pleiotropic drug resistance 3 (.1) AT3G16340 277 / 1e-85 ABCG29, ATPDR1, PDR1, AtABCG29 ATP-binding cassette G29, pleiotropic drug resistance 1 (.1.2) AT1G66950 273 / 4e-84 ABCG39, PDR11, ATPDR11 ATP-binding cassette G39, pleiotropic drug resistance 11 (.1) AT2G36380 269 / 8e-83 ABCG34, PDR6, ATPDR6 ATP-binding cassette G34, pleiotropic drug resistance 6 (.1) AT1G15210 263 / 1e-80 ABCG35, PDR7, ATPDR7 ATP-binding cassette G35, pleiotropic drug resistance 7 (.1) AT1G59870 259 / 4e-79 ATABCG36, ABCG36, PEN3, PDR8, ATPDR8 PENETRATION 3, ARABIDOPSIS PLEIOTROPIC DRUG RESISTANCE 8, Arabidopsis thaliana ATP-binding cassette G36, ATP-binding cassette G36, ABC-2 and Plant PDR ABC-type transporter family protein (.1) AT3G30842 250 / 5e-76 ABCG38, PDR10, ATPDR10 ATP-binding cassette G38, pleiotropic drug resistance 10 (.1) AT4G15233 220 / 1e-65 ABCG42 ATP-binding cassette G42, ABC-2 and Plant PDR ABC-type transporter family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G032900 [exp] 360 / 3e-115 AT1G15520 2041 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G175700 [exp] 358 / 1e-114 AT1G15520 2058 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G049000 [exp] 354 / 3e-114 AT1G15520 1847 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G048800 [exp] 355 / 1e-113 AT1G15520 2034 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.003G179000 [exp] 355 / 2e-113 AT1G15520 2010 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.003G178900 [exp] 353 / 6e-113 AT1G15520 2000 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.006G248500 [exp] 352 / 2e-112 AT1G15520 2050 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G048700 [exp] 351 / 5e-112 AT1G15520 2000 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Potri.001G048900 [exp] 346 / 2e-110 AT1G15520 2055 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041684 [exp] 357 / 7e-122 AT1G15520 899 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10024061 [exp] 362 / 5e-116 AT1G15520 2139 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10024060 [exp] 361 / 6e-116 AT1G15520 2115 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10041683 [exp] 358 / 6e-115 AT1G15520 2019 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10041668 [exp] 347 / 1e-110 AT1G15520 2128 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10008090 [exp] 315 / 7e-99 AT1G15520 2045 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10034020 [exp] 307 / 2e-96 AT1G15520 2029 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10024062 [exp] 299 / 3e-93 AT1G15520 1820 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1) Lus10019453 [exp] 294 / 2e-91 AT2G26910 2354 / 0.0 PERMEABLE CUTICLE 1, ATP-binding cassette G32, pleiotropic drug resistance 4 (.1) Lus10041681 [exp] 285 / 3e-91 AT1G15520 991 / 0.0 Arabidopsis thaliana ATP-binding cassette G40, ATP-binding cassette G40, pleiotropic drug resistance 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0181 [poplar] [flax] ABC-2 PF01061 [poplar] [flax] ABC2_membrane ABC-2 type transporter
Representative CDS sequence Show only first row Show all	>Potri.003G057351.1 pacid=42785132 polypeptide=Potri.003G057351.1.p locus=Potri.003G057351 ID=Potri.003G057351.1.v4.1 annot-version=v4.1 ATGTTTGGGACGATGTTTTGGGACCTTGGCTCTAAAAGGACAAAGGAACAGGATCTGTTGAATGCAATGGGTTCCATGTATACTGCTGTCCTCTTCCTTG GTGTCCAAAATTCTGGAAGCGTGCAGCCAGTAGTCTCGATTGAGAGAACAGTTTTTTACAGAGAAAGGGCTGCTGGAATGTATTCAGCCTTCCCCTATGC CATGGCTCAAGTTGTTGTTGAGCTTCCATACCTTCTTGCACAAGCAGTAGCCTATAGCATCATAGTTTATTCAATGATAGGATTTGAATGGACTGTTGCT AAATTCTTTTGGTATCTATTCTACACGTGCCTCACATTATTTCAGTTCACCTTTTTTGGCATGATGGCTGTGGGTGTTACACCAAATCACCACATGGCTG CCATAGTTTCGACAGCTTTTTACTCAGTTTGGAACCTATTTTCAGGATTTATGGTCCCTGTAACAAGAATTCCTGTATGGTGGAGATGGTTCTACTGGGC ATGCCCAATAGCCTGGACCTTGTATGGATTGCTCGAATCACAATATGGAGATAGAAAAGACATGCTTGACATAGGCGTGACAGTGGATGATTTTATGAGA AAGTATTTTAGTTTCAGACATGATTTTCTGGGAGTGGTTGCGGCCGTGAATGTTGGGTTTGCATTGTTGTTTGCACTTGTCTTTGCCATCTCCTTGAAGA TATTTAATTTCCAAAAAGCGATAGCAGTTTAG
AA sequence Show only first row Show all	>Potri.003G057351.1 pacid=42785132 polypeptide=Potri.003G057351.1.p locus=Potri.003G057351 ID=Potri.003G057351.1.v4.1 annot-version=v4.1 MFGTMFWDLGSKRTKEQDLLNAMGSMYTAVLFLGVQNSGSVQPVVSIERTVFYRERAAGMYSAFPYAMAQVVVELPYLLAQAVAYSIIVYSMIGFEWTVA KFFWYLFYTCLTLFQFTFFGMMAVGVTPNHHMAAIVSTAFYSVWNLFSGFMVPVTRIPVWWRWFYWACPIAWTLYGLLESQYGDRKDMLDIGVTVDDFMR KYFSFRHDFLGVVAAVNVGFALLFALVFAISLKIFNFQKAIAV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Potri.003G057351 [exp]	0	1
AT1G15170			MATE efflux family protein (.1...		Potri.008G126500 [exp]	54.08	0.7019
AT1G79210			N-terminal nucleophile aminohy...		Potri.012G123100 [exp]	66.18	0.7343
AT2G33860	ARF	ARF3, ETT	ETTIN, AUXIN RESPONSE TRANSCRI...		Potri.011G059101 [exp]	84.46	0.7151
AT5G64440		ATFAAH	fatty acid amide hydrolase (.1...		Potri.001G285900 [exp]	107.08	0.6474
AT5G05800			unknown protein		Potri.005G153700 [exp]	121.37	0.6916
AT1G60160			Potassium transporter family p...		Potri.008G147300 [exp]	142.76	0.6710
AT3G21710			unknown protein		Potri.002G230300 [exp]	199.42	0.6451
AT3G25930			Adenine nucleotide alpha hydro...		Potri.010G123300 [exp]	228.00	0.6328

Compare expression of checked genes

Potri.003G057351 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.