Plant FIBer expression Database

Potri.003G058400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G03120 162 / 1e-50 C2H2 and C2HC zinc fingers superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037576
[exp]
215 / 5e-71 AT4G03120 178 / 1e-56 C2H2 and C2HC zinc fingers superfamily protein (.1)
Lus10011434
[exp]
207 / 4e-68 AT4G03120 159 / 4e-49 C2H2 and C2HC zinc fingers superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF06220 zf-U1 U1 zinc finger
Representative CDS sequence
>Potri.003G058400.2 pacid=42784636 polypeptide=Potri.003G058400.2.p locus=Potri.003G058400 ID=Potri.003G058400.2.v4.1 annot-version=v4.1
ATGCCCCGGTATTACTGTGATTATTGTGACACTTACTTGACTCATGATTCTCCATCTGTTAGAAAACAGCACAATGCCGGTTATAAACACAAGGCAAATG
TGAGGATCTATTATCAGCAGTTTGAGGAGCAGCAAACCCAAAGTATAATTGACCAAAGAATAAAGGAACATCTTGGCCAAACTGCAGCTTTTCAACAGGT
TGGTGCCGCATACAATCAGCATCTAATGGTCCAGAGACCCCGGCTTCCTGTTCTTCCAACTCCTGTGATGCCAATTGGAGGAAATAACGCCCCATTATTC
CCTGGGATGAGGCCTCCTGTTTTGCCTAGACCAATGCCTGGTGCTCCAGGTTATATGAACCCTCCTATGATGCCCCCAATGATGGCACCCCCTGGTGCTC
CTTCCTTACCTGGTCAAATGAATGGCATTCCAAGGCCTCCTACAATGATTGCACAACCAAATGTTCCTGGGAGTACTGCAGCACCTACTCCTAGCGGTCC
CCCGTCTATGGGTCCACCTGTTACTTACCAAGCAAATCAAGCAGCAACAACCAGTGGAGGCTTTGACAGCTTCAATGTGAATGCCGCAGCCCCTGAAGCC
AATCATTAG
AA sequence
>Potri.003G058400.2 pacid=42784636 polypeptide=Potri.003G058400.2.p locus=Potri.003G058400 ID=Potri.003G058400.2.v4.1 annot-version=v4.1
MPRYYCDYCDTYLTHDSPSVRKQHNAGYKHKANVRIYYQQFEEQQTQSIIDQRIKEHLGQTAAFQQVGAAYNQHLMVQRPRLPVLPTPVMPIGGNNAPLF
PGMRPPVLPRPMPGAPGYMNPPMMPPMMAPPGAPSLPGQMNGIPRPPTMIAQPNVPGSTAAPTPSGPPSMGPPVTYQANQAATTSGGFDSFNVNAAAPEA
NH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G03120 C2H2 and C2HC zinc fingers sup... Potri.003G058400
[exp]
0 1
AT5G40190 RNA ligase/cyclic nucleotide p... Potri.017G073800
[exp]
1.00 0.8953
AT5G61770 PPAN PETER PAN-like protein (.1.2.3... Potri.014G129700
[exp]
1.41 0.8798
AT1G80245 Spc97 / Spc98 family of spindl... Potri.001G081300
[exp]
2.44 0.8739
AT3G16310 mitotic phosphoprotein N' end ... Potri.001G188300
[exp]
4.89 0.8426
AT3G09250 Nuclear transport factor 2 (NT... Potri.006G093700
[exp]
5.00 0.8598
AT1G09760 U2A' U2 small nuclear ribonucleopro... Potri.001G072100
[exp]
5.65 0.8346
AT3G06790 plastid developmental protein ... Potri.010G007200
[exp]
6.00 0.8542
AT2G20940 Protein of unknown function (D... Potri.009G136100
[exp]
6.32 0.8435
AT1G17530 ATTIM23-1 translocase of inner mitochond... Potri.003G044100
[exp]
10.58 0.8514 Pt-ATTIM23.1
AT1G80750 Ribosomal protein L30/L7 famil... Potri.003G180700
[exp]
11.00 0.8434

Potri.003G058400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.