Potri.003G060366 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G173600 199 / 2e-60 AT3G22780 160 / 5e-41 CHINESE FOR 'UGLY', Tesmin/TSO1-like CXC domain-containing protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G060366.1 pacid=42787292 polypeptide=Potri.003G060366.1.p locus=Potri.003G060366 ID=Potri.003G060366.1.v4.1 annot-version=v4.1
ATGTTTTCAGCTGGAGTAGGATGCTTTGATGGATGCCGATGTGAAGGATATTACAATCATTATGGGAAAAAAAAAACAGAAACAGTTCATAGAAGAGCTG
AAAGAGGGAACAATCCATCTCAGGAGCCACGGGATACTCCAGAGACTCACAGTGATTGTATTAAACCTAATCAATTCTCATCGACATTGGAAGCACTTAC
TGATATAGGCTTTCTGACTCCACCATCGGGTTGTCTCTTAGGTGTGGCTTCTTCAGCTTCTCTAAACTTAAGGGGCTGTCCAAAAATTTCACTAGTTCAA
TCTCAACAAGAAAGCGGCCTCCTCTCATCACCTGGCTACTTTAATTGGCGCCATTCACCTTGTAATTTCATTCCAAAATTATATGGAAGTGAACTTGGTT
CTGACAGCTTTCTCTGTAACAACTTGGAGGATAGTATGCCTGAAACGCTCAAGAACACTTGTACCCCAGTCCCCAGGTACACAGGCGGTGAAATCTTTCT
CACTTAA
AA sequence
>Potri.003G060366.1 pacid=42787292 polypeptide=Potri.003G060366.1.p locus=Potri.003G060366 ID=Potri.003G060366.1.v4.1 annot-version=v4.1
MFSAGVGCFDGCRCEGYYNHYGKKKTETVHRRAERGNNPSQEPRDTPETHSDCIKPNQFSSTLEALTDIGFLTPPSGCLLGVASSASLNLRGCPKISLVQ
SQQESGLLSSPGYFNWRHSPCNFIPKLYGSELGSDSFLCNNLEDSMPETLKNTCTPVPRYTGGEIFLT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G060366 0 1
AT1G75130 CYP721A1 "cytochrome P450, family 721, ... Potri.014G043100 1.41 0.8750
AT1G77380 AAP3, ATAAP3 amino acid permease 3 (.1) Potri.002G079500 1.41 0.8406 PTRAAP8,AAP3.1
Potri.003G060432 2.44 0.8347
AT5G41380 CCT motif family protein (.1) Potri.003G130500 3.46 0.8320
Potri.008G019900 14.31 0.8141
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Potri.011G155600 14.49 0.7569 CYP716C1
AT1G78060 Glycosyl hydrolase family prot... Potri.005G168400 20.34 0.7968
AT1G29740 Leucine-rich repeat transmembr... Potri.011G075400 22.49 0.7478
AT4G33540 metallo-beta-lactamase family ... Potri.008G085751 26.19 0.7962
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Potri.008G187700 28.98 0.7793

Potri.003G060366 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.