Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15660 201 / 6e-67 ATGRX4 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2) AT3G54900 110 / 3e-31 ATGRXCP, CXIP1 GLUTAREDOXIN, CAX interacting protein 1 (.1) AT4G04950 109 / 2e-28 AtGRXS17 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) AT2G38270 96 / 3e-24 ATGRX2, CXIP2 GLUTAREDOXIN, CAX-interacting protein 2 (.1) AT5G20500 53 / 4e-09 Glutaredoxin family protein (.1) AT5G63030 46 / 8e-07 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1) AT2G20270 45 / 4e-06 Thioredoxin superfamily protein (.1.2) AT5G18600 41 / 4e-05 Thioredoxin superfamily protein (.1) AT5G40370 41 / 6e-05 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2) AT5G58530 41 / 0.0001 Glutaredoxin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G141200 [exp] 116 / 3e-33 AT3G54900 197 / 5e-65 GLUTAREDOXIN, CAX interacting protein 1 (.1) Potri.004G042200 [exp] 105 / 6e-27 AT4G04950 750 / 0.0 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Potri.011G051400 [exp] 103 / 3e-26 AT4G04950 680 / 0.0 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Potri.016G119200 [exp] 93 / 3e-23 AT2G38270 393 / 2e-138 GLUTAREDOXIN, CAX-interacting protein 2 (.1) Potri.015G078900 [exp] 47 / 5e-07 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 45 / 1e-06 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1) Potri.018G133400 [exp] 45 / 2e-06 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Potri.008G214600 [exp] 44 / 3e-06 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1) Potri.002G254100 [exp] 45 / 6e-06 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008687 [exp] 185 / 2e-57 AT3G15660 197 / 7e-62 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2) Lus10018487 [exp] 100 / 2e-26 AT4G04950 280 / 5e-93 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Lus10011187 [exp] 98 / 6e-26 AT4G04950 322 / 8e-110 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Lus10041501 [exp] 99 / 1e-25 AT3G54900 159 / 4e-49 GLUTAREDOXIN, CAX interacting protein 1 (.1) Lus10012592 [exp] 98 / 1e-25 AT3G54900 156 / 2e-48 GLUTAREDOXIN, CAX interacting protein 1 (.1) Lus10026132 [exp] 101 / 3e-25 AT3G14460 594 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10002847 [exp] 90 / 1e-21 AT2G38270 384 / 4e-135 GLUTAREDOXIN, CAX-interacting protein 2 (.1) Lus10011188 [exp] 48 / 5e-07 AT4G04950 297 / 1e-99 Arabidopsis thaliana monothiol glutaredoxin 17, thioredoxin family protein (.1) Lus10017148 [exp] 47 / 6e-07 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Lus10022844 [exp] 47 / 8e-07 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00462 [poplar] [flax] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Potri.003G060600.2 pacid=42787462 polypeptide=Potri.003G060600.2.p locus=Potri.003G060600 ID=Potri.003G060600.2.v4.1 annot-version=v4.1 ATGGCAAGGTTACTGTCGAATACAATCTTGAAGGGTATTTCGCGTGCATCACAGTCTCCTAGAATTGTGCCTGCATCTTTTAACCACGTCAAGCTCAGAT TCTCTACCACCATTCCCAATGATCCCGACAGTCATGCAGATTTTCAACCAAATAATAAGGCTGTGAATGAGAGTGGGAGTTGTAGCGGAATTAATATTAA GGAACTTGTTGACAAGGATGTCAAGGAACACCCAATAGTAATTTACATGAAGGGATATCCTGACCTTCCTCAATGTGGATTTAGCGCTCTGGCGGTTAGA GTATTGAAACAATACAATGTTCCGATAACTGCTAGAAATATATTGGAGTATCCTGACCTAAGAACTGGAGTAAAAGCATACAGCAATTGGCCTACATTTC CCCAAATTTTTATCAAGGGAGAGTTTATTGGTGGCTCAGATATAATTATGAATATGCACCAGACTGGCGAACTGAAAGAAAAGCTCCAAGATATTTCAGG AAAAGAGGAGTCTGAATAA
AA sequence Show only first row Show all	>Potri.003G060600.2 pacid=42787462 polypeptide=Potri.003G060600.2.p locus=Potri.003G060600 ID=Potri.003G060600.2.v4.1 annot-version=v4.1 MARLLSNTILKGISRASQSPRIVPASFNHVKLRFSTTIPNDPDSHADFQPNNKAVNESGSCSGINIKELVDKDVKEHPIVIYMKGYPDLPQCGFSALAVR VLKQYNVPITARNILEYPDLRTGVKAYSNWPTFPQIFIKGEFIGGSDIIMNMHQTGELKEKLQDISGKEESE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G15660		ATGRX4	A. THALIANA GLUTAREDOXIN 4, gl...		Potri.003G060600 [exp]	0	1
AT5G27720		LSM4, EMB1644	SM-like protein 4, embryo defe...		Potri.002G205700 [exp]	1.41	0.7911	Pt-GRP2.1
AT1G16470		PAB1	proteasome subunit PAB1 (.1.2)		Potri.012G123550 [exp]	3.00	0.7510
AT4G10130			DNAJ heat shock N-terminal dom...		Potri.014G032000 [exp]	3.87	0.7378
AT5G48870		SAD1	SUPERSENSITIVE TO ABA AND DROU...		Potri.001G277900 [exp]	7.21	0.7937	Pt-SAD1.2
AT1G52740		HTA9	histone H2A protein 9 (.1)		Potri.018G032100 [exp]	11.83	0.7199
AT3G07170			Sterile alpha motif (SAM) doma...		Potri.002G244700 [exp]	13.00	0.7441
AT5G17840			DnaJ/Hsp40 cysteine-rich domai...		Potri.013G066000 [exp]	13.49	0.7042
AT2G28060			5'-AMP-activated protein kinas...		Potri.004G213600 [exp]	14.42	0.7308
AT3G22950		ATARFC1	ADP-ribosylation factor C1 (.1...		Potri.012G139900 [exp]	15.87	0.7156
					Potri.018G104801 [exp]	16.24	0.7829

Compare expression of checked genes

Potri.003G060600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.