Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80160 261 / 2e-90 GLYI7 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) AT1G15380 246 / 1e-84 GLYI4 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) AT2G28420 162 / 2e-51 GLYI8 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) AT5G57040 56 / 7e-10 Lactoylglutathione lyase / glyoxalase I family protein (.1) AT2G32090 50 / 5e-08 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G171600 [exp] 285 / 4e-100 AT1G80160 270 / 6e-94 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.007G129200 [exp] 229 / 3e-78 AT1G80160 225 / 1e-76 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.003G009000 [exp] 192 / 6e-63 AT1G80160 190 / 8e-62 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.004G223300 [exp] 187 / 1e-60 AT1G80160 187 / 1e-60 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.005G117000 [exp] 182 / 3e-59 AT1G80160 166 / 2e-52 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.007G015100 [exp] 180 / 2e-58 AT1G15380 167 / 7e-53 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.009G055500 [exp] 160 / 2e-50 AT2G28420 229 / 1e-77 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Potri.010G087000 [exp] 50 / 3e-08 AT2G32090 189 / 3e-63 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.018G056200 [exp] 50 / 1e-07 AT5G57040 253 / 2e-86 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030070 [exp] 243 / 4e-83 AT1G80160 247 / 7e-85 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10014480 [exp] 240 / 4e-82 AT1G80160 244 / 1e-83 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10025971 [exp] 173 / 2e-55 AT1G15380 165 / 3e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10014269 [exp] 168 / 2e-53 AT1G15380 166 / 2e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10005324 [exp] 162 / 6e-51 AT2G28420 245 / 2e-83 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10039579 [exp] 162 / 9e-51 AT2G28420 248 / 2e-84 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10017158 [exp] 57 / 4e-10 AT5G57040 254 / 7e-87 Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10006122 [exp] 50 / 5e-08 AT2G32090 199 / 3e-67 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10010552 [exp] 49 / 1e-07 AT2G32090 197 / 3e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10021573 [exp] 44 / 9e-06 AT5G57040 163 / 2e-51 Lactoylglutathione lyase / glyoxalase I family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0104 [poplar] [flax] Glyoxalase PF12681 [poplar] [flax] Glyoxalase_2 Glyoxalase-like domain
Representative CDS sequence Show only first row Show all	>Potri.003G062400.1 pacid=42785181 polypeptide=Potri.003G062400.1.p locus=Potri.003G062400 ID=Potri.003G062400.1.v4.1 annot-version=v4.1 ATGGGAAACCCACTTCATCTCAAGTCTTTGAACCACATCTCACTTCTGTGTAAATCACTTGAGGAATCCATTGATTTCTATGAGGATGTTCTTGGTTTTG TGCCGATAAGGAGGCCAGGATCTTTTAACTTTGATGGGGCATGGTTATTTGGTTATGGAATTGGAATTCATCTATTGCAGTCAGAAAATCCAGAAAAGAT GCAGAAGAAAGGTAAAATTAATCCCAAGGACAATCATATCTCCTTCCAGTGTGAGAGTATGGCAGCTGTGGAGAAGAAGTTGAAAGACATGGGAATTCAG CACGTTCGAGCTTTAGTGGAGGAAGGTGGGATCCAAGTTGAACAGCTGTTCTTCCATGACCCTGATGGATTTATGATTGAGATTTGCGATTGTGATAACC TCCCAGTGATCCCTTTGGCTGGCGAAATCGCACAATCATGTTCTTACTTGAACCTCGAAAGGATGCAGCAGCAGATGCAGCCAATGGTGCAGCAGGAGAG AGCAATCTAG
AA sequence Show only first row Show all	>Potri.003G062400.1 pacid=42785181 polypeptide=Potri.003G062400.1.p locus=Potri.003G062400 ID=Potri.003G062400.1.v4.1 annot-version=v4.1 MGNPLHLKSLNHISLLCKSLEESIDFYEDVLGFVPIRRPGSFNFDGAWLFGYGIGIHLLQSENPEKMQKKGKINPKDNHISFQCESMAAVEKKLKDMGIQ HVRALVEEGGIQVEQLFFHDPDGFMIEICDCDNLPVIPLAGEIAQSCSYLNLERMQQQMQPMVQQERAI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G80160		GLYI7	glyoxylase I 7, Lactoylglutath...		Potri.003G062400 [exp]	0	1
AT3G14280			unknown protein		Potri.003G072400 [exp]	6.32	0.8417
AT1G76490		HMGR1, HMG1, At...	3-HYDROXY-3-METHYLGLUTARYL COA...		Potri.009G169900 [exp]	12.56	0.8371
AT2G24720		ATGLR2.2	glutamate receptor 2.2 (.1)		Potri.018G096300 [exp]	14.69	0.8239
AT4G35160			O-methyltransferase family pro...		Potri.004G050400 [exp]	16.97	0.8311	FOMT2,Pt-OOMT2.13
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Potri.010G231500 [exp]	19.59	0.8155
AT2G37110			PLAC8 family protein (.1)		Potri.016G087200 [exp]	20.19	0.7105
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.014G033200 [exp]	20.61	0.8217
AT1G74740		CDPK1A, CPK30, ...	CALCIUM-DEPENDENT PROTEIN KINA...		Potri.015G066200 [exp]	23.91	0.7876	Pt-CDPK1.4
					Potri.002G091600 [exp]	27.20	0.8130
AT2G26560		PLP2, PLAIIA, P...	PATATIN-LIKE PROTEIN 2, phosph...		Potri.014G033000 [exp]	30.49	0.8193

Compare expression of checked genes

Potri.003G062400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.