Potri.003G066101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G40390 62 / 8e-12 DNAse I-like superfamily protein (.1)
AT1G43760 47 / 2e-06 DNAse I-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G186236 259 / 4e-89 AT1G40390 86 / 2e-19 DNAse I-like superfamily protein (.1)
Potri.019G043150 249 / 1e-85 AT1G40390 58 / 3e-10 DNAse I-like superfamily protein (.1)
Potri.014G186733 231 / 3e-78 AT1G40390 70 / 1e-13 DNAse I-like superfamily protein (.1)
Potri.013G100901 160 / 8e-51 AT1G40390 43 / 6e-05 DNAse I-like superfamily protein (.1)
Potri.015G069301 158 / 7e-50 AT1G43760 72 / 6e-15 DNAse I-like superfamily protein (.1)
Potri.T124605 140 / 3e-43 ND /
Potri.004G128901 96 / 6e-24 AT1G43760 149 / 3e-39 DNAse I-like superfamily protein (.1)
Potri.004G128941 96 / 6e-24 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128961 96 / 6e-24 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0530 DNase_I-like PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
Representative CDS sequence
>Potri.003G066101.1 pacid=42787471 polypeptide=Potri.003G066101.1.p locus=Potri.003G066101 ID=Potri.003G066101.1.v4.1 annot-version=v4.1
ATGAAGGTTGAGATTCTTCACTTCTCTGCACAAGGGATACATGTTCAGATTACTAGTTTGGTTCACCAATATAGCTTTACAGCCACCTTCATATACGGTT
TCAACACCATTACTGCCAGGAGAGCTTTGTGGGAGGATTTAAGGAAATGGGGCACGGAATCACCATGGCTTCTTCTTGGTGATTTCAACTATATCCTCTC
TCAAGATGATAAGCATAACGGGGAGCCAGTCTCTAACTATGAAATTTCAGATTTCAGGGAGTGTTGTTCTGATCTTGGGATTGCTGACTTGAACTCTATG
GGTTGTCATTTTACATGGACAAATGGCACAGTGTGGACAAAAATTGATAGGGTTATAGTAAACACTCATTGGTCCACTTTGCAGCAAATAGACCATGTCC
ACTTTGGTACCCTAGGAGCCTTTTTAGACCATTCACCAACTACCATCCAGCTGGGATTTTAG
AA sequence
>Potri.003G066101.1 pacid=42787471 polypeptide=Potri.003G066101.1.p locus=Potri.003G066101 ID=Potri.003G066101.1.v4.1 annot-version=v4.1
MKVEILHFSAQGIHVQITSLVHQYSFTATFIYGFNTITARRALWEDLRKWGTESPWLLLGDFNYILSQDDKHNGEPVSNYEISDFRECCSDLGIADLNSM
GCHFTWTNGTVWTKIDRVIVNTHWSTLQQIDHVHFGTLGAFLDHSPTTIQLGF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G40390 DNAse I-like superfamily prote... Potri.003G066101 0 1
AT5G10490 MSL2 MSCS-like 2 (.1.2.3) Potri.005G107200 2.00 0.7040
AT5G22250 AtCAF1b CCR4- associated factor 1b, Po... Potri.001G038500 4.47 0.6377
AT1G65480 FT FLOWERING LOCUS T, PEBP (phosp... Potri.008G077700 7.93 0.7057 Pt-PNFT3.4
AT2G26450 Plant invertase/pectin methyle... Potri.018G051200 19.62 0.6334
AT5G44265 Bifunctional inhibitor/lipid-t... Potri.007G138400 20.83 0.6176
Potri.010G023851 29.25 0.4673
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Potri.009G083500 33.46 0.5333
AT4G17690 Peroxidase superfamily protein... Potri.012G076500 35.32 0.5369
AT1G70560 CKRC1, WEI8, TA... WEAK ETHYLENE INSENSITIVE 8, S... Potri.010G044500 40.39 0.5949
AT5G27470 seryl-tRNA synthetase / serine... Potri.007G070501 40.55 0.5259

Potri.003G066101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.