Potri.003G067332 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00170 107 / 6e-29 ATCG00170.1, RPOC2 DNA-directed RNA polymerase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G140260 135 / 4e-39 ATCG00170 2104 / 0.0 DNA-directed RNA polymerase family protein (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G067332.1 pacid=42784483 polypeptide=Potri.003G067332.1.p locus=Potri.003G067332 ID=Potri.003G067332.1.v4.1 annot-version=v4.1
ATGCACTGGAGTACTGATGTATACCATGCATCTGAATTTACATATAGTAATGTCCATCTTTTACCAAAAACAAGCCATTTATGGATATTGTCAGGGGGTT
CGTGCAGATCCAGTATAGTCCCGTTTTCACTACACAAGGATCAAGATCAAATAAACGTTCATTCTCTTTCTGTCGAAAGAGGATATATTCTAACCCTTCA
GTAA
AA sequence
>Potri.003G067332.1 pacid=42784483 polypeptide=Potri.003G067332.1.p locus=Potri.003G067332 ID=Potri.003G067332.1.v4.1 annot-version=v4.1
MHWSTDVYHASEFTYSNVHLLPKTSHLWILSGGSCRSSIVPFSLHKDQDQINVHSLSVERGYILTLQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.003G067332 0 1
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.019G028101 2.82 0.9844
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.003G067266 3.16 0.9824
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.019G027720 3.46 0.9879
ATCG00180 ATCG00180.1, RP... DNA-directed RNA polymerase fa... Potri.013G140850 8.12 0.9795
ATCG00150 ATCG00150.1, AT... ATPase, F0 complex, subunit A ... Potri.019G028601 9.48 0.9757
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.013G140260 9.53 0.9788
ATCG00190 ATCG00190.1, RP... RNA polymerase subunit beta (.... Potri.013G142232 10.19 0.9782
ATCG00180 ATCG00180.1, RP... DNA-directed RNA polymerase fa... Potri.019G027860 14.49 0.9688
Potri.011G074501 15.96 0.9662
ATCG00180 ATCG00180.1, RP... DNA-directed RNA polymerase fa... Potri.019G028000 18.02 0.9547

Potri.003G067332 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.