Potri.003G067501 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00630 61 / 7e-15 ATCG00630.1, PSAJ PSAJ (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Representative CDS sequence
>Potri.003G067501.1 pacid=42787178 polypeptide=Potri.003G067501.1.p locus=Potri.003G067501 ID=Potri.003G067501.1.v4.1 annot-version=v4.1
ATGCGAGATCTAAAAACATATCTATTCGTAGCGCCAGTAATAAGTACTCTATGGTTCGGGTCTTTAGCAGGTCTATTGATAGAGATCAATCGTTTTTTTC
CCGGATGCTTTGACATTCCCTTTTTTTTTTCATTCTAG
AA sequence
>Potri.003G067501.1 pacid=42787178 polypeptide=Potri.003G067501.1.p locus=Potri.003G067501 ID=Potri.003G067501.1.v4.1 annot-version=v4.1
MRDLKTYLFVAPVISTLWFGSLAGLLIEINRFFPGCFDIPFFFSF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00630 ATCG00630.1, PS... PSAJ (.1) Potri.003G067501 0 1
ATCG00430 ATCG00430.1, PS... photosystem II reaction center... Potri.013G163100 1.00 0.9435
ATCG00640 ATCG00640.1, RP... ribosomal protein L33 (.1) Potri.003G067400 2.44 0.9206
ATCG00280 ATCG00280.1, PS... photosystem II reaction center... Potri.013G142760 4.47 0.9206
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G113784 10.19 0.8991
ATCG00300 ATCG00300.1, YC... YCF9 (.1) Potri.013G142548 10.95 0.8570
AT5G18475 Pentatricopeptide repeat (PPR)... Potri.002G103600 12.36 0.6822
ATCG01050 ATCG01050.1, ND... NADH-Ubiquinone/plastoquinone ... Potri.008G202133 13.85 0.8361
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.011G074700 13.96 0.8708
ATCG00720 ATCG00720.1, PE... photosynthetic electron transf... Potri.007G062202 14.07 0.8825
ATCG00270 ATCG00270.1, PS... photosystem II reaction center... Potri.013G142201 15.49 0.8529

Potri.003G067501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.