Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17410 229 / 1e-77 Nucleoside diphosphate kinase family protein (.1.2) AT5G63310 93 / 2e-23 NDPK1A, NDPKIAIA, NDPK2, ATNDPK2 NDP KINASE 1A, NUCLEOSIDE DIPHOSPHATE KINASE IA, ARABIDOPSIS NUCLEOSIDE DIPHOSPHATE KINASE 2, nucleoside diphosphate kinase 2 (.1) AT4G09320 89 / 9e-23 NDPK1 Nucleoside diphosphate kinase family protein (.1) AT4G11010 75 / 1e-16 NDPK3 nucleoside diphosphate kinase 3 (.1) AT4G23900 72 / 2e-15 Nucleoside diphosphate kinase family protein (.1) AT4G23895 71 / 9e-15 Pleckstrin homology (PH) domain-containing protein (.1), Pleckstrin homology (PH) domain-containing protein (.2), Pleckstrin homology (PH) domain-containing protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G093800 [exp] 88 / 2e-21 AT5G63310 281 / 1e-96 NDP KINASE 1A, NUCLEOSIDE DIPHOSPHATE KINASE IA, ARABIDOPSIS NUCLEOSIDE DIPHOSPHATE KINASE 2, nucleoside diphosphate kinase 2 (.1) Potri.002G138800 [exp] 84 / 9e-21 AT4G09320 271 / 5e-95 Nucleoside diphosphate kinase family protein (.1) Potri.014G049900 [exp] 81 / 8e-20 AT4G09320 242 / 2e-83 Nucleoside diphosphate kinase family protein (.1) Potri.001G091001 [exp] 75 / 1e-16 AT4G23900 335 / 2e-117 Nucleoside diphosphate kinase family protein (.1) Potri.003G140600 [exp] 71 / 3e-15 AT4G23900 332 / 2e-116 Nucleoside diphosphate kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024286 [exp] 86 / 9e-22 AT4G09320 272 / 3e-95 Nucleoside diphosphate kinase family protein (.1) Lus10014787 [exp] 87 / 4e-21 AT5G63310 301 / 2e-104 NDP KINASE 1A, NUCLEOSIDE DIPHOSPHATE KINASE IA, ARABIDOPSIS NUCLEOSIDE DIPHOSPHATE KINASE 2, nucleoside diphosphate kinase 2 (.1) Lus10003844 [exp] 85 / 4e-21 AT4G09320 264 / 7e-92 Nucleoside diphosphate kinase family protein (.1) Lus10017931 [exp] 87 / 5e-21 AT5G63310 301 / 3e-104 NDP KINASE 1A, NUCLEOSIDE DIPHOSPHATE KINASE IA, ARABIDOPSIS NUCLEOSIDE DIPHOSPHATE KINASE 2, nucleoside diphosphate kinase 2 (.1) Lus10032392 [exp] 77 / 9e-18 AT4G11010 328 / 1e-115 nucleoside diphosphate kinase 3 (.1) Lus10001824 [exp] 76 / 5e-17 AT4G23900 377 / 4e-134 Nucleoside diphosphate kinase family protein (.1) Lus10003878 [exp] 76 / 9e-17 AT4G23900 362 / 6e-128 Nucleoside diphosphate kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00334 [poplar] [flax] NDK Nucleoside diphosphate kinase
Representative CDS sequence Show only first row Show all	>Potri.003G068100.5 pacid=42784998 polypeptide=Potri.003G068100.5.p locus=Potri.003G068100 ID=Potri.003G068100.5.v4.1 annot-version=v4.1 ATGATTCCTCGCCTTTTCTTCTCCGTCCTCTTCCTTGTGCTCGCTGCCTCTTTCCCTATCAGCAGTGGGAGTGAAGAAAAGGAAAAGACGTTAGCTATGA TCAAGCCAGATGGATTGCTAGGTAATTACACTGAAAGGATAAAGGAGGTTATTGTGGATTATGGGTTTAGCATCTTGAGGGAAATTACCGCTCAACTTGA CCAAGACAGTGCTTCAAGCTTTTACGCTGAACACTCTTCAAGAAGTTTCTTTCCGAGTCTTATCAAATACATGACAAGTGGTCCAGTTTTGGTCATGGTC TTGGAGAAGGAAAATGCAATTGCTGATTGGCGCACTTTGATTGGACCAACTGATGCATGCAAAGCTAAGATTACTCATCCTAACAGTATCAGAGCAATGT GCGGGCAGGATTCAGAAAAGAACTGTGTTCATGGTTCAGACTCTCTCCTATCAGCTCAAAGGGAAATCTCATTTTTCTTTGAAGATGTATCTTCAGGTGA AACAAATACAACACATGATGAGCTCTAG
AA sequence Show only first row Show all	>Potri.003G068100.5 pacid=42784998 polypeptide=Potri.003G068100.5.p locus=Potri.003G068100 ID=Potri.003G068100.5.v4.1 annot-version=v4.1 MIPRLFFSVLFLVLAASFPISSGSEEKEKTLAMIKPDGLLGNYTERIKEVIVDYGFSILREITAQLDQDSASSFYAEHSSRSFFPSLIKYMTSGPVLVMV LEKENAIADWRTLIGPTDACKAKITHPNSIRAMCGQDSEKNCVHGSDSLLSAQREISFFFEDVSSGETNTTHDEL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17410			Nucleoside diphosphate kinase ...		Potri.003G068100 [exp]	0	1
AT1G18070			Translation elongation factor ...		Potri.013G093400 [exp]	2.44	0.7701
AT3G20290		ATEHD1	EPS15 homology domain 1 (.1.2)		Potri.001G356300 [exp]	10.67	0.7261
AT2G29690		ATHANSYNAB, ASA...	anthranilate synthase 2 (.1)		Potri.009G044300 [exp]	14.89	0.7450
AT1G48380		HYP7, RHL1	HYPOCOTYL 7, root hair initiat...		Potri.004G069400 [exp]	21.56	0.7273
AT1G56070		LOS1, AT1G56075...	LOW EXPRESSION OF OSMOTICALLY ...		Potri.007G065600 [exp]	24.73	0.7145	Pt-LOS1.2
AT4G16143		IMPA-2	importin alpha isoform 2 (.1.2...		Potri.010G001400 [exp]	26.49	0.6422
AT5G58290		RPT3	regulatory particle triple-A A...		Potri.006G029100 [exp]	33.76	0.6987
AT4G01100		ADNT1	adenine nucleotide transporter...		Potri.003G137500 [exp]	39.54	0.6745
AT4G00090			Transducin/WD40 repeat-like su...		Potri.002G148100 [exp]	46.76	0.6021
AT2G01940	C2H2ZnF	SGR5, ATIDD15	SHOOT GRAVITROPISM 5, ARABIDOP...		Potri.012G040200 [exp]	64.24	0.6739

Compare expression of checked genes

Potri.003G068100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.