Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SEC22.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G11890 429 / 2e-155 ATSEC22, SEC22 SECRETION 22, Synaptobrevin family protein (.1) AT5G52270 115 / 1e-31 SNARE-like superfamily protein (.1) AT5G22360 54 / 1e-08 ATVAMP714 vesicle-associated membrane protein 714 (.1) AT2G25340 53 / 2e-08 ATVAMP712 vesicle-associated membrane protein 712 (.1) AT5G58060 52 / 2e-08 ATYKT61, ATGP1, YKT61 SNARE-like superfamily protein (.1.2) AT4G32150 51 / 7e-08 ATVAMP711, VAMP7C vesicle-associated membrane protein 711 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G165600 [exp] 448 / 7e-163 AT1G11890 427 / 9e-155 SECRETION 22, Synaptobrevin family protein (.1) Potri.012G140600 [exp] 147 / 3e-44 AT5G52270 211 / 2e-69 SNARE-like superfamily protein (.1) Potri.009G018900 [exp] 61 / 5e-11 AT5G22360 367 / 6e-131 vesicle-associated membrane protein 714 (.1) Potri.001G219200 [exp] 59 / 2e-10 AT5G22360 369 / 1e-131 vesicle-associated membrane protein 714 (.1) Potri.006G256200 [exp] 56 / 1e-09 AT4G32150 352 / 5e-125 vesicle-associated membrane protein 711 (.1) Potri.018G025800 [exp] 56 / 3e-09 AT4G32150 366 / 2e-130 vesicle-associated membrane protein 711 (.1) Potri.018G110700 [exp] 54 / 6e-09 AT5G58060 375 / 8e-135 SNARE-like superfamily protein (.1.2) Potri.006G187700 [exp] 53 / 1e-08 AT5G58060 381 / 5e-137 SNARE-like superfamily protein (.1.2) Potri.018G125900 [exp] 53 / 2e-08 AT4G32150 276 / 1e-94 vesicle-associated membrane protein 711 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036987 [exp] 425 / 8e-154 AT1G11890 415 / 6e-150 SECRETION 22, Synaptobrevin family protein (.1) Lus10013175 [exp] 417 / 9e-151 AT1G11890 411 / 2e-148 SECRETION 22, Synaptobrevin family protein (.1) Lus10008135 [exp] 370 / 2e-131 AT1G11890 363 / 7e-129 SECRETION 22, Synaptobrevin family protein (.1) Lus10015808 [exp] 116 / 7e-31 AT5G08530 440 / 6e-153 51 kDa subunit of complex I (.1) Lus10034189 [exp] 54 / 8e-09 AT5G22360 400 / 6e-144 vesicle-associated membrane protein 714 (.1) Lus10043394 [exp] 54 / 8e-09 AT5G22360 400 / 6e-144 vesicle-associated membrane protein 714 (.1) Lus10006192 [exp] 52 / 1e-07 AT5G11150 345 / 9e-121 vesicle-associated membrane protein 713 (.1) Lus10000754 [exp] 49 / 7e-07 AT1G04760 372 / 8e-133 vesicle-associated membrane protein 726 (.1) Lus10041035 [exp] 48 / 8e-07 AT5G11150 343 / 9e-122 vesicle-associated membrane protein 713 (.1) Lus10036297 [exp] 47 / 2e-06 AT5G58060 364 / 3e-130 SNARE-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0445 [poplar] [flax] SNARE-fusion PF00957 [poplar] [flax] Synaptobrevin Synaptobrevin CL0431 [poplar] [flax] PF PF13774 [poplar] [flax] Longin Regulated-SNARE-like domain
Representative CDS sequence Show only first row Show all	>Potri.003G069900.9 pacid=42785497 polypeptide=Potri.003G069900.9.p locus=Potri.003G069900 ID=Potri.003G069900.9.v4.1 annot-version=v4.1 ATGGTGAAGCTGACAATGATTGCTCGTGTTACGGATGGTCTTCCGCTAGCAGAGGGACTGGATGATGGTCGTGATGTGAAAGATGCTGAAATGTACAAAC AGCAGGTCAAGGCACTTTTCAAGAACCTTGCATCTGGCCACAATGATGCTTCGAGGATGTCAATTGAAACTGGCCCTTATATTTTCCATTATATTATTGA AGGACGTATTTGTTACCTCACTATGTGCGACCGTTCTTATCCTAAGAAGCTTGCCTTTCAATACCTAGAAGACCTTAAGAATGAATTTGAGCGTGTCAAT GGGCCTCAAATTGAAACTGCTGCTAGACCATATGCCTTCATTAAATTTGATACTTTTATACAGAAAACAAAAAAATTGTACCAGGACACCCGCACCCAAC GGAATATTGCTAAGTTGAATGATGAGCTGTATGAAGTCCACCAAATAATGACTCGCAATGTGCAGGAAGTTCTGGGTGTTGGTGAAAAGCTGGACCAGGT CAGTCAAATGTCAAGCCGGTTAACATCAGAATCCCGCGTATATGCTGACAAGGCAAGAGATTTGAATCGACAGGCCTTAATTCGAAAGTGGGCCCCTGTT GCCATTGTGCTAGGAGTTGTCTTCCTCCTCTTTTGGATTAAAACAAAGCTCTGGTGA
AA sequence Show only first row Show all	>Potri.003G069900.9 pacid=42785497 polypeptide=Potri.003G069900.9.p locus=Potri.003G069900 ID=Potri.003G069900.9.v4.1 annot-version=v4.1 MVKLTMIARVTDGLPLAEGLDDGRDVKDAEMYKQQVKALFKNLASGHNDASRMSIETGPYIFHYIIEGRICYLTMCDRSYPKKLAFQYLEDLKNEFERVN GPQIETAARPYAFIKFDTFIQKTKKLYQDTRTQRNIAKLNDELYEVHQIMTRNVQEVLGVGEKLDQVSQMSSRLTSESRVYADKARDLNRQALIRKWAPV AIVLGVVFLLFWIKTKLW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G11890		ATSEC22, SEC22	SECRETION 22, Synaptobrevin fa...		Potri.003G069900 [exp]	0	1	SEC22.2
AT5G17070			unknown protein		Potri.019G052400 [exp]	2.00	0.8020
AT2G24765		ARF3, ARL1, ATA...	ARF-LIKE 1, ADP-ribosylation f...		Potri.018G013700 [exp]	2.00	0.8146
AT4G36800		RCE1	RUB1 conjugating enzyme 1 (.1....		Potri.005G126500 [exp]	4.89	0.7853
AT1G02816			Protein of unknown function, D...		Potri.013G014600 [exp]	5.47	0.7699
AT3G17590		CHE1, BSH	BUSHY GROWTH, transcription re...		Potri.010G004100 [exp]	10.48	0.6582	Pt-BSH.1
AT4G30010			unknown protein		Potri.006G075600 [exp]	11.31	0.8092
AT2G30410		TFCA, KIS	TUBULIN FOLDING FACTOR A, tubu...		Potri.013G071100 [exp]	12.96	0.7640	TFCFA,Pt-KIS.1
AT4G22310			Uncharacterised protein family...		Potri.011G023100 [exp]	16.49	0.7803
AT5G07960			unknown protein		Potri.015G056300 [exp]	16.61	0.8051
AT1G67250			Proteasome maturation factor U...		Potri.017G111900 [exp]	16.73	0.8009

Compare expression of checked genes

Potri.003G069900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.