Potri.003G070500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G54070 90 / 5e-24 Dormancy/auxin associated family protein (.1)
AT1G56220 59 / 3e-12 Dormancy/auxin associated family protein (.1.2.3.4)
AT1G28330 42 / 1e-05 DYL1, DRM1 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G164800 120 / 6e-36 AT1G54070 67 / 3e-15 Dormancy/auxin associated family protein (.1)
Potri.005G024250 60 / 2e-12 AT1G56220 86 / 2e-23 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.013G014900 53 / 2e-09 AT1G56220 97 / 7e-27 Dormancy/auxin associated family protein (.1.2.3.4)
Potri.004G047100 40 / 0.0001 AT1G28330 122 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013180 81 / 8e-20 AT1G54070 78 / 5e-19 Dormancy/auxin associated family protein (.1)
Lus10008142 76 / 1e-18 AT1G54070 65 / 1e-14 Dormancy/auxin associated family protein (.1)
Lus10020661 62 / 5e-13 AT1G56220 126 / 2e-38 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10031488 59 / 1e-11 AT1G56220 136 / 3e-42 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10015193 58 / 3e-11 AT1G56220 134 / 3e-41 Dormancy/auxin associated family protein (.1.2.3.4)
Lus10029881 58 / 1e-10 AT5G27830 245 / 9e-80 unknown protein
Lus10013996 39 / 0.0002 AT1G28330 74 / 2e-18 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10015418 39 / 0.0002 AT1G28330 120 / 7e-37 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10013997 39 / 0.0002 AT1G28330 119 / 4e-36 DORMANCY-ASSOCIATED PROTEIN 1, dormancy-associated protein-like 1 (.1.2.3.4.5)
Lus10025446 37 / 0.0006 AT2G33830 82 / 4e-22 Dormancy/auxin associated family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05564 Auxin_repressed Dormancy/auxin associated protein
Representative CDS sequence
>Potri.003G070500.5 pacid=42786027 polypeptide=Potri.003G070500.5.p locus=Potri.003G070500 ID=Potri.003G070500.5.v4.1 annot-version=v4.1
ATGGGATTTCTCCATAAGCTATGGGACGAAACGCTTGCTGGCCCCATGCCGGACAGTGGGCTTGGCAAACTTCGAAAGTATGATTCATTCTCTGTACGAT
CATCACCTCCTGTTGATGCCGCTGCAGCTAATAGCATTGAGGACATGAACATAACTCGGAGCATTACTATTGTTAGGACAAACAGTTCCAAATATTTGAG
GAACATTTCCGTTGATCCTTGTTCATCTCCTGTGTCGCCTGCTACCCCTAGCACTCCTACGACACCTCTGACACCTGGGATCACAGGGACACCACGCGGG
GATTTCAGGAGAATAAAGGCGAGAAAATCGTCAGATGAAGCATTAGAAAGCGGCGAGCCTAGAAGTCTGACTATTTATGATTGGATAGTGATAAATGCTT
TGGATCGTTGA
AA sequence
>Potri.003G070500.5 pacid=42786027 polypeptide=Potri.003G070500.5.p locus=Potri.003G070500 ID=Potri.003G070500.5.v4.1 annot-version=v4.1
MGFLHKLWDETLAGPMPDSGLGKLRKYDSFSVRSSPPVDAAAANSIEDMNITRSITIVRTNSSKYLRNISVDPCSSPVSPATPSTPTTPLTPGITGTPRG
DFRRIKARKSSDEALESGEPRSLTIYDWIVINALDR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G54070 Dormancy/auxin associated fami... Potri.003G070500 0 1
AT4G05070 Wound-responsive family protei... Potri.011G041700 2.44 0.7535
AT5G57655 xylose isomerase family protei... Potri.018G096049 3.46 0.7589
AT1G52720 unknown protein Potri.001G174300 10.95 0.6513
AT3G10740 ATASD1, ARAF1, ... ARABIDOPSIS THALIANA ALPHA-L-A... Potri.006G027700 12.96 0.6995
AT5G21940 unknown protein Potri.018G048100 13.30 0.7343
AT4G35090 CAT2 catalase 2 (.1.2) Potri.005G251600 17.23 0.6819 CAT3,Pt-CAT1.5
AT1G24440 RING/U-box superfamily protein... Potri.008G181300 21.21 0.7085
AT2G24100 ASG1 ALTERED SEED GERMINATION 1, un... Potri.003G185050 21.63 0.6808
AT5G21940 unknown protein Potri.006G219800 24.71 0.6807
AT3G07350 Protein of unknown function (D... Potri.004G184700 35.69 0.6800

Potri.003G070500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.