Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR14
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G12830 54 / 4e-10 SAUR-like auxin-responsive protein family (.1) AT1G56150 50 / 4e-09 SAUR-like auxin-responsive protein family (.1) AT1G79130 49 / 3e-08 SAUR-like auxin-responsive protein family (.1) AT1G19840 48 / 5e-08 SAUR-like auxin-responsive protein family (.1) AT3G43120 47 / 2e-07 SAUR-like auxin-responsive protein family (.1) AT1G16510 45 / 5e-07 SAUR-like auxin-responsive protein family (.1) AT2G24400 45 / 9e-07 SAUR-like auxin-responsive protein family (.1) AT4G31320 45 / 1e-06 SAUR-like auxin-responsive protein family (.1) AT3G20220 44 / 2e-06 SAUR-like auxin-responsive protein family (.1) AT3G20210 44 / 3e-06 DELTAVPE, DELTA-VPE delta vacuolar processing enzyme (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G003900 [exp] 52 / 2e-09 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1) Potri.010G253800 [exp] 51 / 8e-09 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1) Potri.010G226400 [exp] 49 / 1e-08 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1) Potri.005G096400 [exp] 49 / 2e-08 AT3G12830 164 / 2e-53 SAUR-like auxin-responsive protein family (.1) Potri.002G057500 [exp] 48 / 2e-08 AT3G12830 64 / 2e-14 SAUR-like auxin-responsive protein family (.1) Potri.007G067800 [exp] 48 / 4e-08 AT3G12830 148 / 5e-47 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 49 / 5e-08 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 47 / 6e-08 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.005G237000 [exp] 47 / 1e-07 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031178 [exp] 51 / 5e-09 AT1G56150 128 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10037302 [exp] 50 / 3e-08 AT2G24400 150 / 2e-44 SAUR-like auxin-responsive protein family (.1) Lus10035716 [exp] 49 / 5e-08 AT2G24400 157 / 9e-49 SAUR-like auxin-responsive protein family (.1) Lus10031754 [exp] 48 / 6e-08 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1) Lus10012426 [exp] 48 / 6e-08 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1) Lus10042374 [exp] 47 / 9e-08 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1) Lus10026297 [exp] 47 / 1e-07 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 47 / 2e-07 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 46 / 4e-07 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10012190 [exp] 46 / 4e-07 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.003G070900.1 pacid=42785692 polypeptide=Potri.003G070900.1.p locus=Potri.003G070900 ID=Potri.003G070900.1.v4.1 annot-version=v4.1 ATGGGAGTGGGAGTGATAGCGAAGAAGCTGAGCAAATTAATCGGAGCTCGAGGGGTCAAGAGACTAGGAGGTACCACTACTCCATTGCCACCTAAAGGTT ATGTTCCCATTTGCGTAGGGTTTAACAATGATACCAGGCGATTCATTGTTCATACAAAAGCATTTGGCGAGGCAGAGTTCTTGGAGCTTTTGTATAGATC AGCTGAAGAATATGGTTTCGATAATGAAGGAATTCTGAGGATTGCATATGAAGCAAGGGATTTCGAGGAGTGGATGATCACTAGGGCTAAGGGAAAGGTT ATTCCGGTTAAATCCGTCTAA
AA sequence Show only first row Show all	>Potri.003G070900.1 pacid=42785692 polypeptide=Potri.003G070900.1.p locus=Potri.003G070900 ID=Potri.003G070900.1.v4.1 annot-version=v4.1 MGVGVIAKKLSKLIGARGVKRLGGTTTPLPPKGYVPICVGFNNDTRRFIVHTKAFGEAEFLELLYRSAEEYGFDNEGILRIAYEARDFEEWMITRAKGKV IPVKSV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G12830			SAUR-like auxin-responsive pro...		Potri.003G070900 [exp]	0	1	SAUR14
AT3G13080		EST2, ATMRP3, A...	MULTIDRUG RESISTANCE PROTEIN 3...		Potri.003G197100 [exp]	3.74	0.9065
AT2G45360			Protein of unknown function (D...		Potri.014G068900 [exp]	6.00	0.9326
AT3G14470			NB-ARC domain-containing disea...		Potri.017G121500 [exp]	7.21	0.9282
AT2G14900			Gibberellin-regulated family p...		Potri.007G051300 [exp]	9.79	0.9087
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Potri.014G180500 [exp]	12.00	0.9046
AT5G23810		AAP7	amino acid permease 7 (.1.2)		Potri.011G167200 [exp]	16.43	0.8788
AT2G18550	HD	HB-2, ATHB21	homeobox-2, homeobox protein 2...		Potri.005G126100 [exp]	17.02	0.8998
AT3G13080		EST2, ATMRP3, A...	MULTIDRUG RESISTANCE PROTEIN 3...		Potri.003G197101 [exp]	18.33	0.8478
AT4G24975			Plant self-incompatibility pro...		Potri.017G144361 [exp]	19.49	0.8503
AT5G66420			unknown protein		Potri.005G120100 [exp]	19.62	0.9127

Compare expression of checked genes

Potri.003G070900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.