Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G72430 126 / 9e-39 SAUR-like auxin-responsive protein family (.1) AT1G17345 124 / 2e-37 SAUR-like auxin-responsive protein family (.1) AT5G20820 99 / 1e-27 SAUR-like auxin-responsive protein family (.1) AT3G12955 62 / 5e-13 SAUR-like auxin-responsive protein family (.1) AT4G34760 61 / 8e-13 SAUR-like auxin-responsive protein family (.1) AT1G16510 55 / 2e-10 SAUR-like auxin-responsive protein family (.1) AT2G21220 53 / 4e-10 SAUR-like auxin-responsive protein family (.1) AT1G75580 52 / 2e-09 SAUR-like auxin-responsive protein family (.1) AT3G43120 51 / 8e-09 SAUR-like auxin-responsive protein family (.1) AT3G12830 50 / 8e-09 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G164300 [exp] 197 / 3e-66 AT1G72430 108 / 2e-31 SAUR-like auxin-responsive protein family (.1) Potri.006G137000 [exp] 114 / 6e-34 AT5G20820 135 / 3e-42 SAUR-like auxin-responsive protein family (.1) Potri.001G458000 [exp] 78 / 2e-19 AT3G12955 86 / 3e-22 SAUR-like auxin-responsive protein family (.1) Potri.011G143400 [exp] 75 / 3e-18 AT3G12955 91 / 2e-24 SAUR-like auxin-responsive protein family (.1) Potri.007G012800 [exp] 56 / 3e-11 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 54 / 1e-10 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 54 / 2e-10 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.006G211000 [exp] 51 / 4e-09 AT2G36210 130 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.010G224500 [exp] 50 / 1e-08 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037443 [exp] 122 / 9e-37 AT1G72430 114 / 1e-33 SAUR-like auxin-responsive protein family (.1) Lus10013181 [exp] 120 / 6e-36 AT1G72430 119 / 9e-36 SAUR-like auxin-responsive protein family (.1) Lus10031790 [exp] 67 / 5e-15 AT3G12955 98 / 8e-27 SAUR-like auxin-responsive protein family (.1) Lus10012189 [exp] 56 / 8e-11 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10007553 [exp] 53 / 9e-10 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 50 / 1e-08 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 50 / 1e-08 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10031754 [exp] 48 / 1e-07 AT3G12830 170 / 2e-55 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 47 / 1e-07 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10034888 [exp] 48 / 2e-07 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.003G071000.1 pacid=42786141 polypeptide=Potri.003G071000.1.p locus=Potri.003G071000 ID=Potri.003G071000.1.v4.1 annot-version=v4.1 ATGGCAAAGACTTCCAAGTTGACAAAGCTCAAGTCTGCCATAAAGAGGTTGCCATCTTTCACCAAGATAGTCCGCACAAATAGCTCCATTGCTGCTGCTG ACAACGATCACATCGATGGCAAGATTTCAAAGGAACTTCATGCAGTCTATGTTGGAAAGTCAAGGAGGAGATATCTCTTGAGCTCCGATGTCATTTGTCA TCCTCTTTTTCAAGGGCTAATAGACAGGTCAGGCGCTGGTTTTGGTGATGAGGATAATCAAGCAGTTGTTGTTGCTTGTGAGGTTGTCTTGTTTGAGCAC TTGCTGTGGATGATTGAGAGTGGTGGCTCTGATCAGTTGGGGTCCATGGAGGAGCTTGCTGAATTCTATTACACTTGCTGA
AA sequence Show only first row Show all	>Potri.003G071000.1 pacid=42786141 polypeptide=Potri.003G071000.1.p locus=Potri.003G071000 ID=Potri.003G071000.1.v4.1 annot-version=v4.1 MAKTSKLTKLKSAIKRLPSFTKIVRTNSSIAAADNDHIDGKISKELHAVYVGKSRRRYLLSSDVICHPLFQGLIDRSGAGFGDEDNQAVVVACEVVLFEH LLWMIESGGSDQLGSMEELAEFYYTC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G72430			SAUR-like auxin-responsive pro...		Potri.003G071000 [exp]	0	1
AT5G57123			unknown protein		Potri.006G073400 [exp]	4.58	0.8593
AT1G19020			unknown protein		Potri.015G070700 [exp]	11.22	0.8156
AT1G45688			unknown protein		Potri.007G045000 [exp]	11.74	0.8220
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.006G071200 [exp]	15.49	0.7840	Pt-EXT.6
AT4G05350			RING/U-box superfamily protein...		Potri.019G086500 [exp]	16.24	0.7425
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Potri.014G046300 [exp]	16.97	0.8042	Pt-HA1.5
AT2G14900			Gibberellin-regulated family p...		Potri.007G051300 [exp]	21.63	0.8381
AT5G50400		ATPAP27, PAP27	ARABIDOPSIS THALIANA PURPLE AC...		Potri.001G023400 [exp]	26.38	0.8365
AT1G03230			Eukaryotic aspartyl protease f...		Potri.019G064700 [exp]	28.77	0.7957
AT4G00820		IQD17	IQ-domain 17 (.1)		Potri.014G104600 [exp]	28.77	0.7767

Compare expression of checked genes

Potri.003G071000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.