Potri.003G072250 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G036280 62 / 1e-15 ND /
Potri.008G185350 62 / 3e-15 ND /
Potri.016G085101 61 / 6e-15 ND /
Potri.013G056750 58 / 4e-14 ND /
Potri.016G076050 54 / 2e-12 ND /
Potri.003G072050 54 / 3e-12 ND /
Potri.004G152750 50 / 3e-11 ND /
Potri.008G012050 50 / 5e-11 ND /
Potri.011G027001 50 / 9e-11 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G072250.1 pacid=42786490 polypeptide=Potri.003G072250.1.p locus=Potri.003G072250 ID=Potri.003G072250.1.v4.1 annot-version=v4.1
ATGCCAAGGATGTTTTTTCATTTTTTAAAAATCATTTTTGACATCAGCACATCAAAACGATCCAAAAAGTACAAACCGCACTCAATTTTAGCAAAAAAAA
AAATTTGA
AA sequence
>Potri.003G072250.1 pacid=42786490 polypeptide=Potri.003G072250.1.p locus=Potri.003G072250 ID=Potri.003G072250.1.v4.1 annot-version=v4.1
MPRMFFHFLKIIFDISTSKRSKKYKPHSILAKKKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G072250 0 1
Potri.004G073950 55.85 0.4427
AT1G68840 AP2_ERF EDF2, RAV2, RAP... TEMPRANILLO 2, RELATED TO AP2 ... Potri.014G068000 94.34 0.4601
AT5G39050 PMAT1 phenolic glucoside malonyltran... Potri.004G120700 115.20 0.4408

Potri.003G072250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.