Potri.003G073050 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17285 44 / 5e-07 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G162300 72 / 4e-18 AT1G17285 / unknown protein
Potri.010G247750 37 / 0.0003 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G073050.1 pacid=42787470 polypeptide=Potri.003G073050.1.p locus=Potri.003G073050 ID=Potri.003G073050.1.v4.1 annot-version=v4.1
ATGAAGTCATACTCTAGAGCGCTGGCTGCTCTTGCTCTTCTTCTTTCACTACTTCTATCCGCCTCGTTAAACAAAGCTCAAGCAGAGGGTCGTTCTTTGG
CACCACCATCTACCACTTCAGTATCAAGCAAGGCTTCAACTTCACAGGCTTTCAGAGATTTGCAAGCAAATAAGAACCCATTTAAGAAAATTGGTTCAAG
CTTCAGAAGAATACCTCCAAGCAATTCAAATCCCAGACAGAACAAGTGCAAGCCTCAACTAGGCGACTGA
AA sequence
>Potri.003G073050.1 pacid=42787470 polypeptide=Potri.003G073050.1.p locus=Potri.003G073050 ID=Potri.003G073050.1.v4.1 annot-version=v4.1
MKSYSRALAALALLLSLLLSASLNKAQAEGRSLAPPSTTSVSSKASTSQAFRDLQANKNPFKKIGSSFRRIPPSNSNPRQNKCKPQLGD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G17285 unknown protein Potri.003G073050 0 1
AT4G05320 UBQ10 polyubiquitin 10 (.1.2.3.4.5.6... Potri.001G263000 8.54 0.9023 Pt-UBQ11.1
AT1G30760 FAD-binding Berberine family p... Potri.011G160700 10.77 0.8772
AT2G01300 unknown protein Potri.004G092800 12.12 0.8437
Potri.017G069550 14.83 0.8814
AT5G07360 Amidase family protein (.1.2) Potri.015G109400 18.16 0.8391
AT1G30760 FAD-binding Berberine family p... Potri.011G161300 36.00 0.7681
AT3G11310 unknown protein Potri.010G022201 37.68 0.8739
AT1G08080 ATACA7, ACA7 A. THALIANA ALPHA CARBONIC ANH... Potri.004G212800 41.67 0.7390
AT3G16520 UGT88A1 UDP-glucosyl transferase 88A1 ... Potri.004G071000 45.16 0.8638
Potri.001G255904 50.83 0.8655

Potri.003G073050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.