Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17280 171 / 4e-55 UBC34 ubiquitin-conjugating enzyme 34 (.1.2) AT5G50430 169 / 2e-54 UBC33 ubiquitin-conjugating enzyme 33 (.1.2.3) AT3G17000 70 / 3e-15 UBC32 ubiquitin-conjugating enzyme 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G162200 [exp] 196 / 8e-65 AT1G17280 371 / 9e-132 ubiquitin-conjugating enzyme 34 (.1.2) Potri.008G106300 [exp] 69 / 5e-15 AT3G17000 380 / 7e-133 ubiquitin-conjugating enzyme 32 (.1) Potri.010G143900 [exp] 68 / 9e-15 AT3G17000 386 / 1e-135 ubiquitin-conjugating enzyme 32 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003932 [exp] 171 / 9e-55 AT5G50430 368 / 2e-130 ubiquitin-conjugating enzyme 33 (.1.2.3) Lus10037459 [exp] 170 / 3e-52 AT5G50430 374 / 2e-129 ubiquitin-conjugating enzyme 33 (.1.2.3) Lus10016898 [exp] 69 / 8e-15 AT3G17000 397 / 6e-140 ubiquitin-conjugating enzyme 32 (.1) Lus10037759 [exp] 67 / 5e-14 AT3G17000 397 / 1e-139 ubiquitin-conjugating enzyme 32 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.003G073100.3 pacid=42784957 polypeptide=Potri.003G073100.3.p locus=Potri.003G073100 ID=Potri.003G073100.3.v4.1 annot-version=v4.1 ATGATCACTCCCAATGGCCGATTCATGACTCAAAAGAAAATATGCTTATCCATGATTGATTTTCATCCAGAGAGTTGGAACCCCATGTGGTCTGTATCAA GCATACTTACGGGGCTTCTTTCTTTCATGACTGACAACACTCCTACCACAGGAAGTGTGAACACTACTGCTGCTGAGAAGCGACACCTAGCAAAGGATTC TCTTGCTTTCAATTGTAAGAACACGGCATTCAAGAAATTGTTTCCCGAGTATGTAGAGAAGTATAAGCAGGAGCAACACGCCAGGCAGCTTGTTTCAGAG CAAGTGTCATCACAGGTACCACGAGAAGATAAATGCTGA
AA sequence Show only first row Show all	>Potri.003G073100.3 pacid=42784957 polypeptide=Potri.003G073100.3.p locus=Potri.003G073100 ID=Potri.003G073100.3.v4.1 annot-version=v4.1 MITPNGRFMTQKKICLSMIDFHPESWNPMWSVSSILTGLLSFMTDNTPTTGSVNTTAAEKRHLAKDSLAFNCKNTAFKKLFPEYVEKYKQEQHARQLVSE QVSSQVPREDKC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G17280		UBC34	ubiquitin-conjugating enzyme 3...		Potri.003G073100 [exp]	0	1
					Potri.001G466500 [exp]	1.00	0.9550
AT3G50590			Transducin/WD40 repeat-like su...		Potri.005G136300 [exp]	2.00	0.9516
AT3G29180			Protein of unknown function (D...		Potri.017G088000 [exp]	3.46	0.9269
AT1G66680		AR401	S-adenosyl-L-methionine-depend...		Potri.012G068600 [exp]	3.46	0.9356
AT3G54230		SUA	suppressor of abi3-5 (.1.2)		Potri.017G138401 [exp]	4.24	0.9463
AT4G14600			Target SNARE coiled-coil domai...		Potri.002G102400 [exp]	4.89	0.9306
AT2G37150			RING/U-box superfamily protein...		Potri.008G041201 [exp]	5.29	0.9326
AT2G20300		ALE2	Abnormal Leaf Shape 2, Protein...		Potri.002G254600 [exp]	5.47	0.9231
AT3G52120			SWAP (Suppressor-of-White-APri...		Potri.009G064600 [exp]	5.83	0.9208
AT4G30920		AtLAP2, LAP2	leucyl aminopeptidase 2, Cytos...		Potri.006G184500 [exp]	7.34	0.9301

Compare expression of checked genes

Potri.003G073100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.